Cytokeratin 14 Recombinant monoclonal antibody, PBS Only

Cytokeratin 14 Uni-rAb® Recombinant Antibody for WB, IHC, IF-P, Indirect ELISA

Cat No. 83379-1-PBS
Clone No.1H22

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, Indirect ELISA

KRT14, 1H22, CK 14, CK14, CK-14

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83379-1-PBS targets Cytokeratin 14 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag0188

Product name: Recombinant human KRT14 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 262-472 aa of BC002690

Sequence: GQVGGDVNVEMDAAPGVDLSRILNEMRDQYEKMAEKNRKDAEEWFFTKTEELNREVATNSELVQSGKSEISELRRTMQNLEIELQSQLSMKASLENSLEETKGRYCMQLAQIQEMIGSVEEQLAQLRCEMEQQNQEYKILLDVKTRLEQEIATYRRLLEGEDAHLSSSQFSSGSQSSRDVTSSSRQIRTKVMDVHDGKVVSTHEQVLRTKN

Predict reactive species
Full Name keratin 14
Calculated Molecular Weight 472 aa, 52 kDa
Observed Molecular Weight52 kDa
GenBank Accession NumberBC002690
Gene Symbol Cytokeratin 14
Gene ID (NCBI) 3861
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP02533
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Cytokeratin 14, one of about 20 different cytokeratin isotypes of human cells, is the intermediate filament protein characteristic of epithelial cells. Cytokeratin 14 is expressed in the basal compartment of all stratified squamous epithelia. In various kinds of human tumors, the appearance and increasing expression of Cytokeratin 14 were strikingly associated with higher grade and stage of carcinoma, with varying degrees of unfavorable prognosis. In lung squamous cell carcinoma(LSCC), Cytokeratin 14 was expressed in the tumor cell nests showing stromal invasion with fibrosis and lymph node metastases, indicating that Cytokeratin 14 involved in proliferation and metastasis of LSCC. Cytokeratin 14 expression is sometimes used in diagnosis of myoepithelioma1 and intraductal vs. invasive ductal carcinoma of the breast.

Loading...
||
New chat

Able

正在加载,请稍候...