Product Information
25398-1-PBS targets Cytokeratin 40 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21889 Product name: Recombinant human KRT40 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-87 aa of BC150191 Sequence: MTSDCSSTHCSPESCGTASGCAPASSCSVETACLPGTCATSRCQTPSFLSRSRGLTGCLLPCYFTGSCNSPCLVGNCAWCEDGVFTS Predict reactive species |
| Full Name | keratin 40 |
| Calculated Molecular Weight | 431 aa, 48 kDa |
| Observed Molecular Weight | 48 kDa |
| GenBank Accession Number | BC150191 |
| Gene Symbol | Cytokeratin 40 |
| Gene ID (NCBI) | 125115 |
| RRID | AB_2880059 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q6A162 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |

