Cytokeratin 6A Monoclonal antibody

• Home
• Products
• Primary Antibodies
• Cytokeratin 6A Monoclonal antibody (68294-1-Ig)

Cytokeratin 6A Monoclonal Antibody for WB, IHC, ELISA

Cat No. 68294-1-Ig

Clone No.1G1D7

Publications(2)

Host / Isotype

Mouse / IgG1

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

CK 6A, CK 6D, CK6, CK6A, CK6C, CK6D, Cytokeratin 6, Cytokeratin 6A, Cytokeratin 6D, Hom s 5, K6A, K6C, K6D, keratin 6A, KRT conserve, KRT6, KRT6A, KRT6C, KRT6D, Type II keratin Kb6

• 

  WB analysis using 68294-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 68294-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 68294-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 68294-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 68294-1-Ig

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 68294-1-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human oesophagus cancer using 68294-1-Ig

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HaCaT cells, A431 cells, human saliva, rat skin tissue, mouse skin tissue
• Positive IHC detected in: human cervical cancer tissue, human oesophagus cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:1150-1:4600

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

68294-1-Ig targets Cytokeratin 6A in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, rat samples.

• Tested Reactivity: Human, mouse, rat
• Cited Reactivity: mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0882

  Product name: Recombinant human KRT6A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 364-564 aa of BC008807

  Sequence: QVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH

• Full Name: keratin 6A
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC008807
• Gene Symbol: Cytokeratin 6A
• Gene ID (NCBI): 3853
• RRID: AB_2935374
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02538
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 6 is a type II keratin. It is used as a marker for epidermal hyperproliferation and differentiation.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
rat	IF	Cell Host Microbe; Rothia mucilaginosa membrane vesicles stabilize labile iron to alleviate UVB-induced ferroptosis.; Authors - Siyuan Fan
mouse	IF	Cancer Cell; PDGFRα+ITGA11+ fibroblasts foster early-stage cancer lymphovascular invasion and lymphatic metastasis via ITGA11-SELE interplay; Authors - Hanhao Zheng