Cytokeratin 6A Monoclonal antibody, PBS Only

• 

  WB analysis using 68294-1-Ig (same clone as 68294-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68294-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 68294-1-Ig (same clone as 68294-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68294-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 68294-1-Ig (same clone as 68294-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68294-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 68294-1-Ig (same clone as 68294-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68294-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human cervical cancer using 68294-1-Ig (same clone as 68294-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68294-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 68294-1-Ig (same clone as 68294-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68294-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human oesophagus cancer using 68294-1-Ig (same clone as 68294-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human oesophagus cancer tissue slide using 68294-1-Ig (Cytokeratin 6 antibody) at dilution of 1:2300 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 68294-1-PBS in a different storage buffer formulation.

Cytokeratin 6A Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 68294-1-PBS

Clone No.1G1D7

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

Cytokeratin 6, KRT6A, 1G1D7, CK 6A, CK6

---

Product Information

68294-1-PBS targets Cytokeratin 6A in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0882

  Product name: Recombinant human KRT6A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 364-564 aa of BC008807

  Sequence: QVTAGRHGDDLRNTKQEIAEINRMIQRLRSEIDHVKKQCANLQAAIADAEQRGEMALKDAKNKLEGLEDALQKAKQDLARLLKEYQELMNVKLALDVEIATYRKLLEGEECRLNGEGVGQVNISVVQSTVSSGYGGASGVGSGLGLGGGSSYSYGSGLGVGGGFSSSSGRAIGGGLSSVGGGSSTIKYTTTSSSSRKSYKH

• Full Name: keratin 6A
• Calculated Molecular Weight: 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC008807
• Gene Symbol: Cytokeratin 6A
• Gene ID (NCBI): 3853
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P02538
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Keratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. Keratin 6 is a type II keratin. It is used as a marker for epidermal hyperproliferation and differentiation.