D2HGDH Monoclonal antibody, PBS Only

• 

  WB analysis of NIH/3T3 using 66364-1-Ig (same clone as 66364-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 66364-1-Ig (D2HGDH Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66364-1-PBS in a different storage buffer formulation.

• 

  WB analysis of C6 using 66364-1-Ig (same clone as 66364-1-PBS)

  C6 cells were subjected to SDS PAGE followed by western blot with 66364-1-Ig (D2HGDH Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66364-1-PBS in a different storage buffer formulation.

• 

  WB analysis of rat heart using 66364-1-Ig (same clone as 66364-1-PBS)

  rat heart tissue were subjected to SDS PAGE followed by western blot with 66364-1-Ig (D2HGDH Antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66364-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66364-1-Ig (same clone as 66364-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66364-1-Ig (D2HGDH Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66364-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 66364-1-Ig (same clone as 66364-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 66364-1-Ig (D2HGDH Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66364-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66364-1-Ig (same clone as 66364-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using D2HGDH antibody (66364-1-Ig, Clone: 1E9B3 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 66364-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 66364-1-Ig (same clone as 66364-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using D2HGDH antibody (66364-1-Ig, Clone: 1E9B3 ) at dilution of 1:800 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L), CL594-phalloidin (red). This data was developed using the same antibody clone with 66364-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 66364-1-Ig (same clone as 66364-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug Anti-Human D2HGDH (66364-1-Ig, Clone:1E9B3) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 66364-1-PBS in a different storage buffer formulation.

D2HGDH Monoclonal Antibody for WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Cat No. 66364-1-PBS

Clone No.1E9B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), Indirect ELISA

Synonyms

1E9B3, D2HGD, D-2-hydroxyglutarate dehydrogenase, mitochondrial, EC:1.1.99.39

---

Product Information

66364-1-PBS targets D2HGDH in WB, IHC, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5036

  Product name: Recombinant human D2HGDH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-286 aa of BC036604

  Sequence: MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVQRLPFSTVSKQDLAAFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGC

• Full Name: D-2-hydroxyglutarate dehydrogenase
• Calculated Molecular Weight: 521 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC036604
• Gene Symbol: D2HGDH
• Gene ID (NCBI): 728294
• RRID: AB_2881744
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8N465
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

D2HGDH(D-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as D2HGD and belongs to the FAD-binding oxidoreductase/transferase type 4 family.It catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.Defects in D2HGDH are the cause of D-2-hydroxyglutaric aciduria type 1 (D2HGA1).