CoraLite®594-conjugated D2HGDH Monoclonal antibody

• 

  IF Staining of HepG2 using CL594-66364

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using CoraLite®®594 D2HGDH antibody (CL594-66364, Clone: 1E9B3 ) at dilution of 1:100. DAPI (blue).

D2HGDH Monoclonal Antibody for IF/ICC

Cat No. CL594-66364

Clone No.1E9B3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

D2HGD, D2HGDH, FLJ42195

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-66364 targets D2HGDH in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5036

  Product name: Recombinant human D2HGDH protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-286 aa of BC036604

  Sequence: MLPRRPLAWPAWLLRGAPGAAGSWGRPVGPLARRGCCSAPGTPEVPLTRERYPVQRLPFSTVSKQDLAAFERIVPGGVVTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVSGILVCQAGCVLEELSRYVEERDFIMPLDLGAKGSCHIGGNVATNAGGLRFLRYGSLHGTVLGLEVVLADGTVLDCLTSLRKDNTGYDLKQLFIGSEGTLGIITTVSILCPPKPRAVNVAFLGC

• Full Name: D-2-hydroxyglutarate dehydrogenase
• Calculated Molecular Weight: 521 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC036604
• Gene Symbol: D2HGDH
• Gene ID (NCBI): 728294
• RRID: AB_2919981
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q8N465
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

D2HGDH(D-2-hydroxyglutarate dehydrogenase, mitochondrial) is also named as D2HGD and belongs to the FAD-binding oxidoreductase/transferase type 4 family.It catalyzes the oxidation of D-2-hydroxyglutarate to alpha-ketoglutarate.Defects in D2HGDH are the cause of D-2-hydroxyglutaric aciduria type 1 (D2HGA1).