DAB1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DAB1 Polyclonal antibody, PBS Only (31459-1-PBS)

• 

  WB analysis using 31459-1-AP (same clone as 31459-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31459-1-AP (DAB1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31459-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31459-1-AP (same clone as 31459-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31459-1-AP (DAB1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31459-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 31459-1-AP (same clone as 31459-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 31459-1-AP (DAB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31459-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 31459-1-AP (same clone as 31459-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 31459-1-AP (DAB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31459-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 31459-1-AP (same clone as 31459-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 31459-1-AP (DAB1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31459-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse cerebellum using 31459-1-AP (same clone as 31459-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse cerebellum tissue slide using 31459-1-AP (DAB1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 31459-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 31459-1-AP (same clone as 31459-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DAB1 antibody (31459-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 31459-1-PBS in a different storage buffer formulation.

DAB1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 31459-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat, pig

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Disabled homolog 1

---

Product Information

31459-1-PBS targets DAB1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat, pig samples.

• Tested Reactivity: human, mouse, rat, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35376

  Product name: Recombinant human DAB1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 132-280 aa of NM_021080

  Sequence: KEGNHRFVAIKTAQAAEPVILDLRDLFQLIYELKQREELEKKAQKDKQCEQAVYQTILEEDVEDPVYQYIVFEAGHEPIRDPETEENIYQVPTSQKKEGVYDVPKSQPVSNGYSFEDFEERFAAATPNRNLPTDFDEIFEATKAVTQLE

• Full Name: disabled homolog 1 (Drosophila)
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 45 kDa, 80 kDa
• GenBank Accession Number: NM_021080
• Gene Symbol: DAB1
• Gene ID (NCBI): 1600
• RRID: AB_3742431
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: O75553
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Disabled-1 (Dab1) is an adaptor protein that is essential for neuronal migration and maturation in response to the extracellular protein Reelin. DAB1 protein docks to the intracellular part of the Reelin very low density lipoprotein receptor and apoE receptor type 2 and becomes tyrosine-phosphorylated following binding of Reelin to cortical neurons. The DAB1 protein contains a 180-amino acid N-terminal protein interaction/phosphotyrosine-binding (PTB) 1 domain that docks to the short cytoplasmic tail of the very low density lipoprotein receptor or apoE receptor type 2 at the level of NPXY motifs, with a preference for unphosphorylated motifs. Dab1 polypeptide bands ranging from 36 to 120 kDa have been identified in mouse embryonic brain, the 80-kDa Dab1 being the predominant form (PMID: 24313315).