DAPP1 Recombinant monoclonal antibody, PBS Only

DAPP1 Uni-rAb® Recombinant Antibody for WB, Indirect ELISA
Cat No. 85346-1-PBS
Clone No.242582D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

BAM32, B-cell adapter molecule of 32 kDa, DAPP 1, Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide, hDAPP1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85346-1-PBS targets DAPP1 in WB, Indirect ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag6459

Product name: Recombinant human DAPP1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-280 aa of BC012924

Sequence: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK

Predict reactive species
Full Name dual adaptor of phosphotyrosine and 3-phosphoinositides
Calculated Molecular Weight 32 kDa
Observed Molecular Weight32 kDa
GenBank Accession NumberBC012924
Gene Symbol DAPP1
Gene ID (NCBI) 27071
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9UN19
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DAPP1 was identified as dual adaptor for phosphotyrosine and 3-phosphoinositides, a novel 280 amino acid protein which contains a putative myristoylation site at its N-terminus followed by a SH2 and a PH domain at its C-terminus (PMID: 10432293). DAPP1 is also referred to B cell adaptor molecule of 32 kDa (Bam32), and is expressed by B lymphocytes, but not T lymphocytes or nonhematopoietic cells. DAPP1/Bam32 was shown to regulate BCR signaling downstream of phosphatidylinositol 3-kinase (PI3K) (PMID: 10770799). Furthermore, DAPP1/Bam32 may server to integrate PI3K and Src kinase signaling to promote Rac-dependent B cell adhesive interactions important for antigen presentation function (PMID: 20495066).

Loading...
||
New chat Able
正在加载,请稍候...