DAPP1 Recombinant monoclonal antibody

• 

  WB analysis using 85346-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85346-1-RR (DAPP1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. Jurkat cells as negative control.

• 

  Affinity and Kinetic Characterization of 85346-1-RR

  Biolayer interferometry (BLl) kinetic assays of 85346-1-RR against Human DAPP1 were performed. The affinity constant is 8.12 nM.

DAPP1 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 85346-1-RR

Clone No.242582D1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

BAM32, B-cell adapter molecule of 32 kDa, DAPP 1, Dual adapter for phosphotyrosine and 3-phosphotyrosine and 3-phosphoinositide, hDAPP1

---

Tested Applications

• Positive WB detected in: Daudi cells, Ramos cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85346-1-RR targets DAPP1 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag6459

  Product name: Recombinant human DAPP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-280 aa of BC012924

  Sequence: MGRAELLEGKMSTQDPSDLWSRSDGEAELLQDLGWYHGNLTRHAAEALLLSNGCDGSYLLRDSNETTGLYSLSVRAKDSVKHFHVEYTGYSFKFGFNEFSSLKDFVKHFANQPLIGSETGTLMVLKHPYPRKVEEPSIYESVRVHTAMQTGRTEDDLVPTAPSLGTKEGYLTKQGGLVKTWKTRWFTLHRNELKYFKDQMSPEPIRILDLTECSAVQFDYSQERVNCFCLVFPFRTFYLCAKTGVEADEWIKILRWKLSQIRKQLNQGEGTIRSRSFIFK

• Full Name: dual adaptor of phosphotyrosine and 3-phosphoinositides
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa
• GenBank Accession Number: BC012924
• Gene Symbol: DAPP1
• Gene ID (NCBI): 27071
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UN19
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DAPP1 was identified as dual adaptor for phosphotyrosine and 3-phosphoinositides, a novel 280 amino acid protein which contains a putative myristoylation site at its N-terminus followed by a SH2 and a PH domain at its C-terminus (PMID: 10432293). DAPP1 is also referred to B cell adaptor molecule of 32 kDa (Bam32), and is expressed by B lymphocytes, but not T lymphocytes or nonhematopoietic cells. DAPP1/Bam32 was shown to regulate BCR signaling downstream of phosphatidylinositol 3-kinase (PI3K) (PMID: 10770799). Furthermore, DAPP1/Bam32 may server to integrate PI3K and Src kinase signaling to promote Rac-dependent B cell adhesive interactions important for antigen presentation function (PMID: 20495066).