DAXX Monoclonal antibody, PBS Only

• 

  WB analysis of Raji using 67879-1-Ig (same clone as 67879-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 67879-1-Ig (DAXX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67879-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Daudi using 67879-1-Ig (same clone as 67879-1-PBS)

  Daudi cells were subjected to SDS PAGE followed by western blot with 67879-1-Ig (DAXX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67879-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MOLT-4 using 67879-1-Ig (same clone as 67879-1-PBS)

  MOLT-4 cells were subjected to SDS PAGE followed by western blot with 67879-1-Ig (DAXX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67879-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67879-1-Ig (same clone as 67879-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67879-1-Ig (DAXX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67879-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 67879-1-Ig (same clone as 67879-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67879-1-Ig (DAXX antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67879-1-Ig (same clone as 67879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67879-1-Ig (DAXX antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67879-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67879-1-Ig (same clone as 67879-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67879-1-Ig (DAXX antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67879-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 67879-1-Ig (same clone as 67879-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DAXX antibody (67879-1-Ig, Clone: 1F3G9 ) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67879-1-PBS in a different storage buffer formulation.

DAXX Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 67879-1-PBS

Clone No.1F3G9

Host / Isotype

Mouse / IgG2b

Reactivity

Human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

BING2, DAP6, DAXX, EAP1, ETS1 associated protein 1, hDaxx

---

Product Information

67879-1-PBS targets DAXX in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14606

  Product name: Recombinant human DAXX protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-349 aa of BC109074

  Sequence: MATANSIIVLDDDDEDEAAAQPGPSHPLPNAASPGAEAPSSSEPHGARGSSSSGGKKCYKLENEKLFEEFLELCKMQTADHPEVVPFLYNRQQRAHSLFLASAEFCNILSRVLSRARSRPAKLYVYINELCTVLKAHSAKKKLNLAPAATTSNEPSGNNPPTHLSLDPTNAENTASQSPRTRGSRRQIQRLEQLLALYVAEIRRLQEKELDLSELDDPDSAYLQEARLKRKLIRLFGRLCELKDCSSLTGRVIEQRIPYRGTRYPEVNRRIERLINKPGPDTFPDYGDVLRAVEKAAARHSLGLPRQQLQLMAQDAFRDVGIRLQERRHLDLIYNFGCHLTDDYRPGVD

• Full Name: death-domain associated protein
• Calculated Molecular Weight: 740 aa, 81 kDa
• Observed Molecular Weight: 100-130 kDa
• GenBank Accession Number: BC109074
• Gene Symbol: DAXX
• Gene ID (NCBI): 1616
• RRID: AB_2918636
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9UER7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Death domain-associated protein (DAXX) is a transcription repressor involved in both physiological and pathological conditions. DAXX overexpression is a common feature in diverse cancers, which correlates with tumorigenesis, disease progression and treatment resistance. Daxx migrated with an apparent molecular weight of approximately 100-130 kDa. (PMID: 31350900, PMID: 32203224, PMID: 31614769)