CoraLite®594-conjugated BRINP1 Monoclonal antibody

• 

  IF Staining of MCF-7 using CL594-60336

  Immunofluorescent analysis of (-20°C Ethanol) fixed MCF-7 cells using CL594-60336 (DBC1 antibody) at dilution of 1:100.

BRINP1 Monoclonal Antibody for IF/ICC

Cat No. CL594-60336

Clone No.2A10E3

Host / Isotype

Mouse / IgG2c

Reactivity

human, pig, mouse

Applications

IF/ICC

Synonyms

DBC1, DBCCR1, deleted in bladder cancer 1, FAM5A, Protein FAM5A

---

Tested Applications

• Positive IF/ICC detected in: MCF-7 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL594-60336 targets BRINP1 in IF/ICC applications and shows reactivity with human, pig, mouse samples.

• Tested Reactivity: human, pig, mouse
• Host / Isotype: Mouse / IgG2c
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6588

  Product name: Recombinant human DBC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-306 aa of BC021560

  Sequence: MNWRFVELLYFLFIWGRISVQPSHQEPAGTDQHVSKEFDWLISDRGPFHHSRSYLSFVERHRQGFTTRYKIYREFARWKVRNTAIERRDLVRHPVPLMPEFQRSIRLLGRRPTTQQFIDTIIKKYGTHLLISATLGGEEALTMYMDKSRLDRKSGNATQSVEALHQLASSYFVDRDGTMRRLHEIQISTGAIKVTETRTGPLGCNSYDNLDSVSSVLLQSTESKLHLQGLQIIFPQYLQEKFVQSALSYIMCNGEGEYLCQNSQCRCQCAEEFPQCNCPITDIQIMEYTLANMAKSWAEAYKDLEN

• Full Name: deleted in bladder cancer 1
• Calculated Molecular Weight: 761 aa, 88 kDa
• Observed Molecular Weight: 88 kDa
• GenBank Accession Number: BC021560
• Gene Symbol: BRINP1
• Gene ID (NCBI): 1620
• RRID: AB_2883467
• Conjugate: CoraLite®594 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 588 nm / 604 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60477
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

BRINP1, also known as DBC1 and FAM5A, inhibits cell proliferation by negative regulation of the G1/S transition. It mediates cell death which is not of the classical apoptotic type and regulates expression of components of the plasminogen pathway.