DCBLD2 Polyclonal antibody

• 

  WB analysis using 30245-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30245-1-AP (DCBLD2 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human stomach cancer using 30245-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30245-1-AP (DCBLD2 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human stomach cancer using 30245-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 30245-1-AP (DCBLD2 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

DCBLD2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30245-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

ESDN, Endothelial and smooth muscle cell-derived neuropilin-like protein, Discoidin, CUB and LCCL domain-containing protein 2, CUB, LCCL and coagulation factor V/VIII-homology domains protein 1, CLCP1

---

Tested Applications

• Positive WB detected in: A549 cells, U2OS cells
• Positive IHC detected in: human stomach cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

30245-1-AP targets DCBLD2 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32823

  Product name: Recombinant human DCBLD2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 582-743 aa of BC029658

  Sequence: LQADSAEYAQPLVGGIVGTLHQRSTFKPEEGKEAGYADLDPYNSPGQEVYHAYAEPLPITGPEYATPIIMDMSGHPTTSVGQPSTSTFKATGNQPPPLVGTYNTLLSRTDSCSSAQAQYDTPKAGKPGLPAPDELVYQVPQSTQEVSGAGRDGECDVFKEIL

• Full Name: discoidin, CUB and LCCL domain containing 2
• Calculated Molecular Weight: 775 aa, 89 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC029658
• Gene Symbol: DCBLD2
• Gene ID (NCBI): 131566
• RRID: AB_3086277
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PD2
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DCBLD2, also known as ESDN or CLCP1, was first identified from human coronary arterial cells by a signal sequence trap method. DCBLD2 regulates proliferation, migration, and invasion in various tumors, including glioma, hypopharyngeal squamous cell carcinoma, and myxofibrosarcoma. The human DCBLD2 protein has a predicted molecular mass of ∼80 kDa based on its amino acid sequence, although it regularly displays an effective molecular mass of ∼130 kDa via SDS-PAGE (PMID: 30902898).