DCC-Specific Monoclonal antibody, PBS Only

DCC-Specific Monoclonal Antibody for WB, Indirect ELISA
Cat No. 67203-1-PBS
Clone No.2G4G4

Host / Isotype

Mouse / IgG2a

Reactivity

Human, Mouse

Applications

WB, Indirect ELISA

Colorectal cancer suppressor, CRC18, CRCR1, DCC, DCC-Specific, IGDCC1, Netrin receptor DCC, Tumor suppressor protein DCC

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67203-1-PBS targets DCC-Specific in WB, Indirect ELISA applications and shows reactivity with Human, Mouse samples.

Tested Reactivity Human, Mouse
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag20569

Product name: Recombinant human DCC-Specific protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 25-364 aa of NM_005215

Sequence: AHLQVTGFQIKAFTALRFLSEPSDAVTMRGGNVLLDCSAESDRGVPVIKWKKDGIHLALGMDERKQQLSNGSLLIQNILHSRHHKPDEGLYQCEASLGDSGSIISRTAKVAVAGPLRFLSQTESVTAFMGDTVLLKCEVIGEPMPTIHWQKNQQDLTPIPGDSRVVVLPSGALQISRLQPGDIGIYRCSARNPASSRTGNEAEVRILSDPGLHRQLYFLQRPSNVVAIEGKDAVLECCVSGYPPPSFTWLRGEEVIQLRSKKYSLLGGSNLLISNVTDDDSGMYTCVVTYKNENISASAELTVLVPPWFLNHPSNLYAYESMDIEFECTVSGKPVPTVNW

Predict reactive species
Full Name deleted in colorectal carcinoma
Calculated Molecular Weight 1447 aa, 158 kDa
Observed Molecular Weight 180 kDa
GenBank Accession NumberNM_005215
Gene Symbol DCC
Gene ID (NCBI) 1630
RRIDAB_2882496
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP43146
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DCC, also named as IGDCC1, belongs to the immunoglobulin superfamily and DCC family. DCC is a receptor for netrin required for axon guidance. DCC plays a key role in the developing nervous system. Its association with UNC5 proteins may trigger signaling for axon repulsion. It also acts as a dependence receptor required for apoptosis induction when not associated with netrin ligand. DCC gene is a tumor suppressor gene. This antibody recognizes endogenous DCC with an apparent molecular weight of 180 kDa. As the predicted molecular mass of DCC is 158 kDa, the slower mobility is likely attributable to post-translational modification, perhaps by glycosylation at potential N-linked glycosylation sites (PMID: 7926722; 8044801).

Loading...
||
New chat Able
正在加载,请稍候...