DCLRE1B Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCLRE1B Polyclonal antibody, PBS Only (13203-1-PBS)

• 

  WB analysis of Jurkat using 13203-1-AP (same clone as 13203-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 13203-1-AP (DCLRE1B antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13203-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 13203-1-AP (same clone as 13203-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13203-1-AP (DCLRE1B Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13203-1-PBS in a different storage buffer formulation.

DCLRE1B Polyclonal Antibody for WB, Indirect ELISA

Cat No. 13203-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

5 exonuclease Apollo, 5' exonuclease Apollo, APOLLO, Beta-lactamase DCLRE1B, DNA cross-link repair 1B protein

---

Product Information

13203-1-PBS targets DCLRE1B in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3945

  Product name: Recombinant human DCLRE1B protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 183-532 aa of BC029687

  Sequence: SLGKESLLEQLALEFQTWVVLSPRRLELVQLLGLADVFTVEEKAGRIHAVDHMEICHSNMLRWNQTHPTIAILPTSRKIHSSHPDIHVIPYSDHSSYSELRAFVAALKPCQVVPIVSRRPCGGFQDSLSPRISVPLIPDSVQQYMSSSSRKPSLLWLLERRLKRPRTQGVVFESPEESADQSQADRDSKKAKKEKLSPWPADLEKQPSHHPLRIKKQLFPDLYSKEWNKAVPFCESQKRVTMLTAPLGFSVHLRSTDEEFISQKTREEIGLGSPLVPMGDDDGGPEATGNQSAWMGHGSPLSHSSKGTPLLATEFRGLALKYLLTPVNFFQAGYSSRRFDQQVEKYHKPC

• Full Name: DNA cross-link repair 1B (PSO2 homolog, S. cerevisiae)
• Calculated Molecular Weight: 532 aa, 60 kDa
• Observed Molecular Weight: 60 kDa
• GenBank Accession Number: BC029687
• Gene Symbol: DCLRE1B
• Gene ID (NCBI): 64858
• RRID: AB_2292695
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H816
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Interstrand cross-links (ICLs) is an extremely cytotoxic form of DNA damage that covalently tethers the two strands of the double helix, which inhibits fundamental nuclear functions, including transcription and DNA replication [PMID:21701511]. DCLRE1B is one of several evolutionarily conserved genes involved in repair of interstrand cross-links [PMID:10848582]. Furthermore, DCLRE1B was identified as a TRF2-interacting protein and, has a role in telomere maintenance in association with the Shelterin complex, preventing non-homologous end-joining-mediated chromosome fusions protecting leading strand telomeres [PMID:20619712].