DCT Monoclonal antibody, PBS Only

• 

  WB analysis of A375 using 68114-1-Ig (same clone as 68114-1-PBS)

  A375 cells were subjected to SDS PAGE followed by western blot with 68114-1-Ig (DCT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68114-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HL-60 using 68114-1-Ig (same clone as 68114-1-PBS)

  HL-60 cells were subjected to SDS PAGE followed by western blot with 68114-1-Ig (DCT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68114-1-PBS in a different storage buffer formulation.

• 

  WB analysis of pig skin using 68114-1-Ig (same clone as 68114-1-PBS)

  pig skin tissue were subjected to SDS PAGE followed by western blot with 68114-1-Ig (DCT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68114-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse testis using 68114-1-Ig (same clone as 68114-1-PBS)

  mouse testis tissue were subjected to SDS PAGE followed by western blot with 68114-1-Ig (DCT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68114-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skin using 68114-1-Ig (same clone as 68114-1-PBS)

  mouse skin tissue were subjected to SDS PAGE followed by western blot with 68114-1-Ig (DCT antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 68114-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A549 using 68114-1-Ig (same clone as 68114-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A549 cells using DCT antibody (68114-1-Ig, Clone: 1B3D4 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 68114-1-PBS in a different storage buffer formulation.

DCT Monoclonal Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 68114-1-PBS

Clone No.1B3D4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, pig

Applications

WB, IF/ICC, Indirect ELISA

Synonyms

1B3D4, DT, EC:5.3.3.12, L-dopachrome Delta-isomerase, L-dopachrome tautomerase

---

Product Information

68114-1-PBS targets DCT in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, pig samples.

• Tested Reactivity: human, mouse, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26165

  Product name: Recombinant human DCT protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-350 aa of BC028311

  Sequence: MSPLWWGFLLSCLGCKILPGAQGQFPRVCMTVDSLVNKECCPRLGAESANVCGSQQGRGQCTEVRADTRPWSGPYILRNQDDRELWPRKFFHRTCKCTGNFAGYNCGDCKFGWTGPNCERKKPPVIRQNIHSLSPQEREQFLGALDLAKKRVHPDYVITTQHWLGLLGPNGTQPQFANCSVYDFFVWLHYYSVRDTLLGPGRPYRAIDFSHQGPAFVTWHRYHLLCLERDLQRLIGNESFALPYWNFATGRNECDVCTDQLFGAARPDDPTLISRNSRFSSWETVCDSLDDYNHLVTLCNGTYEGLLRRNQMGRNSMKLPTLKDIRDCLSLQKFDNPPFFQNSTFSFRNA

• Full Name: dopachrome tautomerase (dopachrome delta-isomerase, tyrosine-related protein 2)
• Calculated Molecular Weight: 519 aa, 59 kDa
• Observed Molecular Weight: 55-63 kDa
• GenBank Accession Number: BC028311
• Gene Symbol: DCT
• Gene ID (NCBI): 1638
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P40126
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCT(L-dopachrome Delta-isomerase) is also named as TYRP2,TRP2 and belongs to the tyrosinase family.human TYRP2 protein has 83% identity and 90% similarity to the mouse sequence and has all the structural characteristics of the tyrosinase protein family, including a signal peptide, 15 conserved cysteine residues, 2 copper-binding domains, and a C-terminal membrane-spanning region(PMID:8206391).