DCTN3 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCTN3 Polyclonal antibody, PBS Only (11325-1-PBS)

• 

  WB analysis using 11325-1-AP (same clone as 11325-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11325-1-AP (DCTN3 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11325-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11325-1-AP (same clone as 11325-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11325-1-AP (DCTN3 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11325-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 11325-1-AP (same clone as 11325-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 11325-1-AP (DCTN3 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11325-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 11325-1-AP (same clone as 11325-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 11325-1-AP (DCTN3 antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11325-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 11325-1-AP (same clone as 11325-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 11325-1-AP (DCTN3 antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11325-1-PBS in a different storage buffer formulation.

DCTN3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11325-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

DCTN 22, DCTN 3, DCTN22, dynactin 3 (p22), p22

---

Product Information

11325-1-PBS targets DCTN3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1865

  Product name: Recombinant human DCTN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-176 aa of BC000319

  Sequence: MAGLTDLQRLQARVEELERWVYGPGGARGSRKVADGLVKVQVALGNISSKRERVKILYKKIEDLIKYLDPEYIDRIAIPDASKLQFILAEEQFILSQVALLEQVNALVPMLDSAHIKAVPEHAARLQRLAQIHIQQQAPWGVGVRDEAGSLVEDVGFAQFLSVLHFGPTGPVCGNH

• Full Name: dynactin 3 (p22)
• Calculated Molecular Weight: 186 aa, 21 kDa
• Observed Molecular Weight: 22 kDa
• GenBank Accession Number: BC000319
• Gene Symbol: DCTN3
• Gene ID (NCBI): 11258
• RRID: AB_3741816
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O75935
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCTN3 (Dynactin Subunit 3, also known as p22) is a core component of the dynactin complex, essential for cytoplasmic dynein-mediated intracellular transport. This 22-kDa polypeptide binds directly to microtubules and stabilizes the dynactin structure, facilitating cargo movement along microtubule tracks. DCTN3 plays critical roles in mitotic spindle organization, vesicle trafficking, and neuronal development (PMID: 24352458).