DCTPP1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCTPP1 Polyclonal antibody, PBS Only (16684-1-PBS)

• 

  WB analysis of HeLa using 16684-1-AP (same clone as 16684-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16684-1-AP (DCTPP1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16684-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 16684-1-AP (same clone as 16684-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 16684-1-AP (DCTPP1 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16684-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Transfected HEK-293 using 16684-1-AP (same clone as 16684-1-PBS)

  Transfected HEK-293 cells were subjected to SDS PAGE followed by western blot with 16684-1-AP (DCTPP1 Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16684-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16684-1-AP (same clone as 16684-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16684-1-AP (DCTPP1 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16684-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 16684-1-AP (same clone as 16684-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 16684-1-AP (DCTPP1 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 16684-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 16684-1-AP (same clone as 16684-1-PBS)

  Immunofluorescent analysis of HeLa cells using 16684-1-AP (DCTPP1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16684-1-PBS in a different storage buffer formulation.

DCTPP1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 16684-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

---

Product Information

16684-1-PBS targets DCTPP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag10015

  Product name: Recombinant human DCTPP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-170 aa of BC001344

  Sequence: MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAELFQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRKYTELPHGAISEDQAVGPADIPCDSTGQTST

• Full Name: dCTP pyrophosphatase 1
• Calculated Molecular Weight: 19 kDa
• Observed Molecular Weight: 19 kDa, 40 kDa, 80 kDa
• GenBank Accession Number: BC001344
• Gene Symbol: DCTPP1
• Gene ID (NCBI): 79077
• RRID: AB_2878299
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H773
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DCTPP1, also named as XTP3TPA, CDAO3 and RS21C6, is a hydrolyzes deoxynucleoside triphosphates (dNTPs) to the corresponding nucleoside monophosphates. It has a central role in the balance of dCTP and the metabolism of deoxycytidine analogues, thus contributing to the preservation of genome integrity. DCTPP1 has some forms such as monomer (~20 kDa), Dimer (~40 kDa) and Homotetramer (~80 kDa).