DCUN1D1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DCUN1D1 Polyclonal antibody, PBS Only (10965-1-PBS)

• 

  WB analysis using 10965-1-AP (same clone as 10965-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10965-1-AP (DCUN1D1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10965-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 10965-1-AP (same clone as 10965-1-PBS)

  WB result of DCUN1D1 antibody (10965-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DCUN1D1 transfected Jurkat cells. This data was developed using the same antibody clone with 10965-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 10965-1-AP (same clone as 10965-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10965-1-AP (DCUN1D1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10965-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human gliomas using 10965-1-AP (same clone as 10965-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human gliomas tissue slide using 10965-1-AP (DCUN1D1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10965-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DCUN1D1 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 10965-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

DCN1, DCN1 like protein 1, DCN1-like protein 1, DCNL1, DCUN 1D1

---

Product Information

10965-1-PBS targets DCUN1D1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1440

  Product name: Recombinant human DCUN1D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC009478

  Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

• Full Name: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC009478
• Gene Symbol: DCUN1D1
• Gene ID (NCBI): 54165
• RRID: AB_2088355
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96GG9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

It has been found that DCUN1D1, also known as squamous cell carcinoma-related oncogene, expression may play a role in development of brain metastasis in patients with Non-small cell lung carcinoma (NSCLC). DCUN1D1-positive tumor cells may have the ability to disrupt the blood-brain-barrier and colonize the brain. Those results suggest that DCUN1D1 may play a role in the brain parenchyma invasion.