DCUN1D1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 85849-4-RR (same clone as 85849-4-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 85849-4-RR (DCUN1D1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 85849-4-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 85849-4-RR

  Biolayer interferometry (BLl) kinetic assays of 85849-4-RR against Human DCUN1D1 were performed. The affinity constant is 23.8 pM.

DCUN1D1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 85849-4-PBS

Clone No.250196B5

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

DCN1, DCN1 like protein 1, DCN1-like protein 1, DCNL1, DCUN 1D1

---

Product Information

85849-4-PBS targets DCUN1D1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1440

  Product name: Recombinant human DCUN1D1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-259 aa of BC009478

  Sequence: MNKLKSSQKDKVRQFMIFTQSSEKTAVSCLSQNDWKLDVATDNFFQNPELYIRESVKGSLDRKKLEQLYNRYKDPQDENKIGIDGIQQFCDDLALDPASISVLIIAWKFRAATQCEFSKQEFMDGMTELGCDSIEKLKAQIPKMEQELKEPGRFKDFYQFTFNFAKNPGQKGLDLEMAIAYWNLVLNGRFKFLDLWNKFLLEHHKRSIPKDTWNLLLDFSTMIADDMSNYDEEGAWPVLIDDFVEFARPQIAGTKSTTV

• Full Name: DCN1, defective in cullin neddylation 1, domain containing 1 (S. cerevisiae)
• Calculated Molecular Weight: 30 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC009478
• Gene Symbol: DCUN1D1
• Gene ID (NCBI): 54165
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96GG9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

It has been found that DCUN1D1, also known as squamous cell carcinoma-related oncogene, expression may play a role in development of brain metastasis in patients with Non-small cell lung carcinoma (NSCLC). DCUN1D1-positive tumor cells may have the ability to disrupt the blood-brain-barrier and colonize the brain.