Product Information
31696-1-PBS targets DCUN1D2 in IP, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag36310 Product name: Recombinant human DCUN1D2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 16-73 aa of BC056669 Sequence: MACTQAGERTAIYCLTQNEWRLDEATDSFFQNPDSLHRESMRNAVDKKKLERLYGRYK Predict reactive species |
| Full Name | DCN1, defective in cullin neddylation 1, domain containing 2 (S. cerevisiae) |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC056669 |
| Gene Symbol | DCUN1D2 |
| Gene ID (NCBI) | 55208 |
| RRID | AB_3742463 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q6PH85 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
DCUN1D2 (DCN1-like protein 2), also known as DCNL2. It is predicted to be located in the cytoplasm and nucleus. Mostly expressed in liver, kidney and brain (PMID: 26906416). Contributes to the neddylation of all cullins by transferring NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes and plays an essential role in the regulation of SCF (SKP1-CUL1-F-box protein)-type complexes activity (PMID: 19617556). The molecular weight of DCUN1D2 is 30 kDa.
