• Featured Product
  • KD/KO Validated

DDB1 Monoclonal antibody, PBS Only

DDB1 Monoclonal Antibody for WB, IHC, Indirect ELISA
Cat No. 66010-1-PBS
Clone No.4F6C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

DDB p127 subunit, DDB1, DDBA, DNA damage binding protein 1, DNA damage binding protein a, HBV X associated protein 1, UV damaged DNA binding factor, UV DDB 1, UV DDB1, XAP 1, XAP1, XPCE, XPE, XPE BF, XPE binding factor

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66010-1-PBS targets DDB1 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17903

Product name: Recombinant human DDB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-400 aa of BC011686

Sequence: MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA

Predict reactive species
Full Name damage-specific DNA binding protein 1, 127kDa
Calculated Molecular Weight 1140 aa, 127 kDa
Observed Molecular Weight 127 kDa
GenBank Accession NumberBC011686
Gene Symbol DDB1
Gene ID (NCBI) 1642
RRIDAB_10950859
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16531
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DDB1, also named as XAP1, XPCe, DDBa and XPE-BF, belongs to the DDB1 family. It is required for DNA repair. DDB1 binds to DDB2 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. This antibody is specific to DDB1.

Loading...
||
New chat Able
正在加载,请稍候...