• Featured Product
  • KD/KO Validated

DDB1 Monoclonal antibody

DDB1 Monoclonal Antibody for WB, IHC, ELISA
Cat No. 66010-1-Ig
Clone No.4F6C6

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

DDB p127 subunit, DDB1, DDBA, DNA damage binding protein 1, DNA damage binding protein a, HBV X associated protein 1, UV damaged DNA binding factor, UV DDB 1, UV DDB1, XAP 1, XAP1, XPCE, XPE, XPE BF, XPE binding factor

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, MCF-7 cells, A549 cells, HEK-293 cells, Jurkat cells, HSC-T6 cells, PC-12 cells, NIH/3T3 cells, RAW 264.7 cells
Positive IHC detected inhuman appendicitis tissue, human colon cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66010-1-Ig targets DDB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag17903

Product name: Recombinant human DDB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-400 aa of BC011686

Sequence: MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA

Predict reactive species
Full Name damage-specific DNA binding protein 1, 127kDa
Calculated Molecular Weight 1140 aa, 127 kDa
Observed Molecular Weight 127 kDa
GenBank Accession NumberBC011686
Gene Symbol DDB1
Gene ID (NCBI) 1642
RRIDAB_10950859
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ16531
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDB1, also named as XAP1, XPCe, DDBa and XPE-BF, belongs to the DDB1 family. It is required for DNA repair. DDB1 binds to DDB2 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. This antibody is specific to DDB1.

Protocols

Product Specific Protocols
IF protocol for DDB1 antibody 66010-1-IgDownload protocol
IHC protocol for DDB1 antibody 66010-1-IgDownload protocol
WB protocol for DDB1 antibody 66010-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

J Clin Invest

Cul4A-DDB1-mediated monoubiquitination of phosphoglycerate dehydrogenase promotes colorectal cancer metastasis via increased S-adenosylmethionine.

Authors - Yajuan Zhang
  • KD Validated
humanWB

J Virol

Degradation of SAMHD1 by Vpx is Independent of Uncoating.

Authors - Paula Jáuregui
  • KD Validated
humanWB

J Virol

Human herpesvirus 6A U4 inhibits proteasomal degradation of amyloid precursor protein.

Authors - Tian Tang
  • KD Validated
Loading...
||
New chat Able
正在加载,请稍候...