DDB2 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DDB2 Polyclonal antibody, PBS Only (30173-1-PBS)

• 

  WB analysis using 30173-1-AP (same clone as 30173-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30173-1-AP (DDB2 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30173-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30173-1-AP (same clone as 30173-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30173-1-AP (DDB2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30173-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30173-1-AP (same clone as 30173-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30173-1-AP (DDB2 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30173-1-PBS in a different storage buffer formulation.

DDB2 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 30173-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

30173-1-PBS targets DDB2 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag32811

  Product name: Recombinant human DDB2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 46-320 aa of NM_000107

  Sequence: RRCDSDCLWVGLAGPQILPPCRSIVRTLHQHKLGRASWPSVQQGLQQSFLHTLDSYRILQKAAPFDRRATSLAWHPTHPSTVAVGSKGGDIMLWNFGIKDKPTFIKGIGAGGSITGLKFNPLNTNQFYASSMEGTTRLQDFKGNILRVFASSDTINIWFCSLDVSASSRMVVTGDNVGNVILLNMDGKELWNLRMHKKKVTHVALNPCCDWFLATASVDQTVKIWDLRQVRGKASFLYSLPHRHPVNAACFSPDGARLLTTDQKSEIRVYSASQW

• Full Name: damage-specific DNA binding protein 2, 48kDa
• Calculated Molecular Weight: 48 kDa
• Observed Molecular Weight: 48-51 kDa
• GenBank Accession Number: NM_000107
• Gene Symbol: DDB2
• Gene ID (NCBI): 1643
• RRID: AB_2935524
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q92466
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DDB2, also named as DNA damage-binding protein 2 or UV-damaged DNA-binding protein 2, is a 427 amino acid protein, which contains seven WD repeats and belongs to the WD repeat DDB2/WDR76 family. DDB2 is ubiquitously expressed, with highest levels in corneal endothelium and lowest levels in brain. DDB2 localizes in the nucleus and is required for DNA repair. DDB2 regulates negatively the constitutive expression of the SOD2 gene in breast cancer cells and exerts, at least in part, a control of breast cancer cell growth. DDB2 can play a role as oncogene and may become a promising candidate as a predictive marker in breast cancer.