DDOST Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DDOST Polyclonal antibody, PBS Only (14916-1-PBS)

• 

  WB analysis using 14916-1-AP (same clone as 14916-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14916-1-AP (DDOST antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 14916-1-AP (same clone as 14916-1-PBS)

  WB result of DDOST antibody (14916-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDOST transfected HeLa cells. This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 14916-1-AP (same clone as 14916-1-PBS)

  WB result of DDOST antibody (14916-1-AP; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDOST transfected A549 cells. This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse pancreas using 14916-1-AP (same clone as 14916-1-PBS)

  IP result of anti-DDOST (IP:14916-1-AP, 4ug; Detection:14916-1-AP 1:1000) with mouse pancreas tissue lysate 3200 ug. This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14916-1-AP (same clone as 14916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 14916-1-AP (same clone as 14916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat small intestine using 14916-1-AP (same clone as 14916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat small intestine using 14916-1-AP (same clone as 14916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat small intestine tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 14916-1-AP (same clone as 14916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 14916-1-AP (same clone as 14916-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 14916-1-AP (DDOST antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 14916-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

DDOST Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 14916-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit, KIAA0115, OK/SW cl.45, OK/SW-cl.45, OST48

---

Product Information

14916-1-PBS targets DDOST in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag6727

  Product name: Recombinant human DDOST protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 92-433 aa of BC002594

  Sequence: FLYDNLIIFSPSVEDFGGNINVETISAFIDGGGSVLVAASSDIGDPLRELGSECGIEFDEEKTAVIDHHNYDISDLGQHTLIVADTENLLKAPTIVGKSSLNPILFRGVGMVADPDNPLVLDILTGSSTSYSFFPDKPITQYPHAVGKNTLLIAGLQARNNARVIFSGSLDFFSDSFFNSAVQKAAPGSQRYSQTGNYELAVALSRWVFKEEGVLRVGPVSHHRVGETAPPNAYTVTDLVEYSIVIQQLSNGKWVPFDGDDIQLEFVRIDPFVRTFLKKKGGKYSVQFKLPDVYGVFQFKVDYNRLGYTHLYSSTQVSVRPLQHTQYERFIPSAYPYYASAF

• Full Name: dolichyl-diphosphooligosaccharide-protein glycosyltransferase
• Calculated Molecular Weight: 49 kDa
• Observed Molecular Weight: 48 kDa
• GenBank Accession Number: BC002594
• Gene Symbol: DDOST
• Gene ID (NCBI): 1650
• RRID: AB_2230534
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P39656
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DDOST (Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit), also known as OST48, is an integral membrane protein and a core component of the oligosaccharyltransferase (OST) complex located in the endoplasmic reticulum (ER). It plays a critical role in the transfer of pre-assembled oligosaccharide chains to asparagine residues of nascent polypeptides, a fundamental process known as N-linked protein glycosylation. Beyond its enzymatic function, DDOST contributes to protein folding quality control, endoplasmic reticulum-associated degradation (ERAD), and the unfolded protein response (UPR). Altered expression of DDOST has been implicated in cancer progression, metastasis, and chemoresistance.