• Featured Product
  • KD/KO Validated

DDX17 Polyclonal antibody

DDX17 Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA
Cat No. 19910-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA, PLA

DDX 17, DEAD box protein 17, DEAD box protein p72, DEAD box protein p82, EC:3.6.4.13

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse brain tissue, HEK-293T cells, HEK-293 cells, rat brain tissue
Positive IP detected inmouse brain tissue
Positive IHC detected inhuman kidney tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

19910-1-AP targets DDX17 in WB, IHC, IF/ICC, IP, CoIP, ChIP, ELISA, PLA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13723

Product name: Recombinant human DDX17,P72 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 381-729 aa of BC000595

Sequence: NLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 17
Calculated Molecular Weight 729 aa, 80 kDa
Observed Molecular Weight 72-80 kDa
GenBank Accession NumberBC000595
Gene Symbol DDX17
Gene ID (NCBI) 10521
RRIDAB_10667004
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92841
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX17, also named as DEAD box protein p72 and DEAD box protein p82, is a 729 amino acid protein, which belongs to the DEAD box helicase family. DDX5/DBP2 subfamily. DDX17 is widely expressed. Levels tend to increase during colon cancer progression, from very low in benign hyperplastic polyps to very high in tubular and villous adenomas. DDX17 as an RNA helicase unwinds RNA and alters RNA structures through ATP binding and hydrolysis. DDX17 is involved in multiple cellular processes, including pre-mRNA splicing, alternative splicing, ribosomal RNA processing and miRNA processing, as well as transcription regulation. It Regulates the alternative splicing of exons exhibiting specific features. identification and characterisation of p72, a novel human nuclear DEAD box protein, which shows a striking homology to p68. This antibody could detect the 72 kDa isoform and 80 kDa isoform of DDX17.

Protocols

Product Specific Protocols
WB protocol for DDX17 antibody 19910-1-APDownload protocol
IHC protocol for DDX17 antibody 19910-1-APDownload protocol
IF protocol for DDX17 antibody 19910-1-APDownload protocol
IP protocol for DDX17 antibody 19910-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanCoIP,chIP

Nat Commun

Intragenic recruitment of NF-κB drives splicing modifications upon activation by the oncogene Tax of HTLV-1.

Authors - Lamya Ben Ameur
humanIP

Nucleic Acids Res

The RNA helicase DDX17 controls the transcriptional activity of REST and the expression of proneural microRNAs in neuronal differentiation.

Authors - Marie-Pierre Lambert
humanWB,IP

Nucleic Acids Res

RNA helicase-dependent gene looping impacts messenger RNA processing

Authors - Sophie Terrone
  • KD Validated
mouse,humanWB,IHC

Clin Transl Med

DEAD-Box Helicase 17 exacerbates non-alcoholic steatohepatitis via transcriptional repression of cyp2c29, inducing hepatic lipid metabolism disorder and eliciting the activation of M1 macrophages

Authors - Deng Ning
humanWB

PLoS Pathog

Hepatitis B virus Core protein nuclear interactome identifies SRSF10 as a host RNA-binding protein restricting HBV RNA production.

Authors - Hélène Chabrolles
WB

Front Immunol

HBx Mediated Increase of DDX17 Contributes to HBV-Related Hepatocellular Carcinoma Tumorigenesis.

Authors - Mei-Ling Dong

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Roy (Verified Customer) (06-15-2024)

Great antibody to detect DDX17 by WB (Overnight incubation at 4°C, 1/1000 dilution)

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/1000
  • Cell Tissue Type: HeLa
FH

N (Verified Customer) (01-28-2023)

Perfect to detect double bands of DDX17.

  • Applications: Western Blot
  • Primary Antibody Dilution: 1:2000
  • Cell Tissue Type: mouse cortex lysate
DDX17 Antibody Western Blot validation (1:2000 dilution) in mouse cortex lysate (Cat no:19910-1-AP)
Loading...
||
New chat Able
正在加载,请稍候...