• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated DDX17 Polyclonal antibody

DDX17 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-19910

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

DDX17, DEAD box protein 17, DEAD box protein p72, DEAD box protein p82, EC:3.6.4.13, Probable ATP-dependent RNA helicase DDX17, RNA-dependent helicase p72, DDX 17

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inHEK-293 cells
Positive FC detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
Flow Cytometry (FC)FC : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-19910 targets DDX17 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag13723

Product name: Recombinant human DDX17,P72 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 381-729 aa of BC000595

Sequence: NLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDVKFVINYDYPNSSEDYVHRIGRTARSTNKGTAYTFFTPGNLKQARELIKVLEEANQAINPKLMQLVDHRGGGGGGGGRSRYRTTSSANNPNLMYQDECDRRLRGVKDGGRRDSASYRDRSETDRAGYANGSGYGSPNSAFGAQAGQYTYGQGTYGAAAYGTSSYTAQEYGAGTYGASSTTSTGRSSQSSSQQFSGIGRSGQQPQPLMSQQFAQPPGATNMIGYMGQTAYQYPPPPPPPPPSRK

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 17
Calculated Molecular Weight 729 aa, 80 kDa
Observed Molecular Weight 72-80 kDa
GenBank Accession NumberBC000595
Gene Symbol DDX17
Gene ID (NCBI) 10521
RRIDAB_3672710
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ92841
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DDX17, also named as DEAD box protein p72 and DEAD box protein p82, is a 729 amino acid protein, which belongs to the DEAD box helicase family. DDX5/DBP2 subfamily. DDX17 is widely expressed. Levels tend to increase during colon cancer progression, from very low in benign hyperplastic polyps to very high in tubular and villous adenomas. DDX17 as an RNA helicase unwinds RNA and alters RNA structures through ATP binding and hydrolysis. DDX17 is involved in multiple cellular processes, including pre-mRNA splicing, alternative splicing, ribosomal RNA processing and miRNA processing, as well as transcription regulation. It Regulates the alternative splicing of exons exhibiting specific features. identification and characterisation of p72, a novel human nuclear DEAD box protein, which shows a striking homology to p68. a predicted molecular mass of DDX17 is 72 kDa, but endogenous DDX17 migrates aberrantly at 79 kDa on SDS-PAGE (PMID: 8871553).

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DDX17 antibody CL488-19910Download protocol
FC protocol for CL Plus 488 DDX17 antibody CL488-19910Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...