DDX18 Recombinant monoclonal antibody

• 

  WB analysis using 85789-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85789-2-RR (DDX18 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 85789-2-RR

  Immunofluorescent analysis of (4% PFA) fixed HeLa cells using DDX18 antibody (85789-2-RR, Clone: 250053A4 ) at dilution of 1:2500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

DDX18 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, ELISA

Cat No. 85789-2-RR

Clone No.250053A4

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IF/ICC, ELISA

Synonyms

ATP-dependent RNA helicase DDX18, cPERP-D, DEAD box protein 18, EC:3.6.4.13, MrDb

---

Tested Applications

• Positive WB detected in: HEK-293T cells, HeLa cells, K-562 cells, Jurkat cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:1250-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85789-2-RR targets DDX18 in WB, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag27457

  Product name: Recombinant human DDX18 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 7-165 aa of BC001238

  Sequence: KLLRKKIEKRNLKLRQRNLKFQGASNLTLSETQNGDVSEETMGSRKVKKSKQKPMNVGLSETQNGGMSQEAVGNIKVTKSPQKSTVLTNGEAAMQSSNSESKKKKKKKRKMVNDAEPDTKKAKTENKGKSEEESAETTKETENNVEKPDNDEDESEVPS

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 18
• Calculated Molecular Weight: 75 kDa
• Observed Molecular Weight: 80 kDa
• GenBank Accession Number: BC001238
• Gene Symbol: DDX18
• Gene ID (NCBI): 8886
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9NVP1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX18 (DEAD-box helicase 18) is a protein belonging to the DEAD-box deconjugating enzyme family that is widely involved in RNA metabolism. It plays a key role in the assembly of the ribosomal small subunit (SSU) and ensures efficient intracellular protein synthesis. DDX18 unwinds RNA double strands through its deconjugating enzyme activity, which is essential for the proper processing and functional execution of RNA molecules. In addition, DDX18 is a multifunctional RNA deconjugating enzyme involved in a variety of signaling pathways, playing a key role not only in ribosome assembly and RNA metabolism, but also in the regulation of a variety of biological processes such as cell cycle, genome stability and stem cell pluripotency.