DDX19A Recombinant monoclonal antibody

DDX19A Uni-rAb® Recombinant Antibody for WB, FC (Intra), ELISA
Cat No. 83106-1-RR
Clone No.230232B12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, FC (Intra), ELISA

EC:3.6.4.13, DDX19-like protein, DDX19L, DDX19 DDX19L, ATP-dependent RNA helicase DDX19A

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HeLa cells, K-562 cells, HepG2 cells, mouse thymus tissue
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

83106-1-RR targets DDX19A in WB, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7362

Product name: Recombinant human DDX19A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 124-478 aa of BC005162

Sequence: MMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-As) box polypeptide 19A
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 54 kDa
GenBank Accession NumberBC005162
Gene Symbol DDX19A
Gene ID (NCBI) 55308
RRIDAB_3670818
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NUU7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX19A, also known as DDX19L, belongs to the DEAD-box helicase family. DDX19A was identified as a novel cytosolic RNA sensor that could activate the NLRP3 inflammasome during virus infection. In addition, DDX19A was proven to be associated with NADPH oxidase 1 (NOX1)-mediated oxidative stress in tumor necrosis factor (TNF)-α-induced A549 cell (PMID: 33968728). It may represent biomarkers of metastasis and novel therapeutic targets in CSCC patients.

Protocols

Product Specific Protocols
IHC protocol for DDX19A antibody 83106-1-RRDownload protocol
WB protocol for DDX19A antibody 83106-1-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...