CoraLite® Plus 750-conjugated DDX19A Recombinant monoclonal antibody

DDX19A Uni-rAb® Recombinant Antibody for WB
Cat No. CL750-83106
Clone No.230232B12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB

EC:3.6.4.13, DDX19-like protein, DDX19L, DDX19 DDX19L, ATP-dependent RNA helicase DDX19A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 750
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHEK-293 cells, HepG2 cells, HeLa cells, K-562 cells
Positive FC (Intra) detected inU2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:1000
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL750-83106 targets DDX19A in WB applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag7362

Product name: Recombinant human DDX19A protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 124-478 aa of BC005162

Sequence: MMLAEPPQNLIAQSQSGTGKTAAFVLAMLSRVEPSDRYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKISEQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDSVWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLAAELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDNETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-As) box polypeptide 19A
Calculated Molecular Weight 54 kDa
Observed Molecular Weight 54 kDa
GenBank Accession NumberBC005162
Gene Symbol DDX19A
Gene ID (NCBI) 55308
RRIDAB_3673768
Conjugate CoraLite® Plus 750 Fluorescent Dye
Excitation/Emission Maxima Wavelengths755 nm / 780 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ9NUU7
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DDX19A, also known as DDX19L, belongs to the DEAD-box helicase family. DDX19A was identified as a novel cytosolic RNA sensor that could activate the NLRP3 inflammasome during virus infection. In addition, DDX19A was proven to be associated with NADPH oxidase 1 (NOX1)-mediated oxidative stress in tumor necrosis factor (TNF)-α-induced A549 cell (PMID: 33968728). It may represent biomarkers of metastasis and novel therapeutic targets in CSCC patients.

Protocols

Product Specific Protocols
FC protocol for CL Plus 750 DDX19A antibody CL750-83106Download protocol
WB protocol for CL Plus 750 DDX19A antibody CL750-83106Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...