Tested Applications
| Positive WB detected in | COLO 320 cells, HeLa cells, Jurkat cells, PC-3 cells, HepG2 cells |
| Positive IP detected in | COLO 320 cells |
| Positive IHC detected in | human colon cancer tissue, human breast cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
10528-1-AP targets DDX21 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, chIP, RIP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, pig |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0804 Product name: Recombinant human DDX21 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC008071 Sequence: MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 |
| Calculated Molecular Weight | 87 kDa |
| Observed Molecular Weight | 87 kDa |
| GenBank Accession Number | BC008071 |
| Gene Symbol | DDX21 |
| Gene ID (NCBI) | 9188 |
| RRID | AB_2092705 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NR30 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing. DDX21 exists as two isoforms, molecular weight of modified isoform one is about 87 -100 kDa, and the post-modified isoform is about 75-85 kDa. Catalog# 10528-1-AP is a rabbit polyclonal antibody raised against N-terminal of human DDX21.
Protocols
| Product Specific Protocols | |
|---|---|
| FC protocol for DDX21 antibody 10528-1-AP | Download protocol |
| IF protocol for DDX21 antibody 10528-1-AP | Download protocol |
| IHC protocol for DDX21 antibody 10528-1-AP | Download protocol |
| IP protocol for DDX21 antibody 10528-1-AP | Download protocol |
| WB protocol for DDX21 antibody 10528-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DDX21 Polyclonal antibody (catalog #10528-1-AP) has 54 citations. These appear in leading journals including Nature, Science, Cell, Cell Metabolism, Cancer Research, Nature Communications, Molecular Cell, Nucleic Acids Research, Science Advances, Developmental Cell, Cell Reports, and the Journal of Biological Chemistry. Research fields span RNA biology and ribosome biogenesis, transcription regulation, DNA damage repair, RNA splicing, RNA modifications (m6A), phase separation, viral replication (HCMV, HPV, SARS-CoV-2, dengue), and oncology, including cancer metastasis, biomarkers, and immunotherapy.
| Species | Application | Title |
|---|---|---|
Science lncRNA SLERT controls phase separation of FC/DFCs to facilitate Pol I transcription. | ||
Cell Glucose dissociates DDX21 dimers to regulate mRNA splicing and tissue differentiation
| ||
Cell Metab NSUN2 is a glucose sensor suppressing cGAS/STING to maintain tumorigenesis and immunotherapy resistance | ||
Cancer Res The roles of RNA helicases in DNA damage repair and tumorigenesis reveal precision therapeutic strategies.
|
Reviews
What customers say
Both reviewers rated the product 5 stars. One user performed immunofluorescence on P19-derived neurons at 1:200 and reported very good signal, though they recommended using a higher dilution. The other user performed Western Blot on Hek293 nuclear/cytoplasmic fractions at 1:1000 and observed a strong band at the expected DDX21 molecular weight with correct nuclear localization. Overall, users found the antibody specific and reliable for both IF and WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Alexandra (Verified Customer) (09-04-2023) | Very good signal. I would recommend a much higher dilution than 1:200.
 |
Wael (Verified Customer) (12-13-2022) | Hek293 fractionated to nuclear and cytoplasmic fractions, DDX21 antibody detects strong band at the expected size of DDX21 and showing nuclear localization as expected
 |
