• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated DDX21 Polyclonal antibody

DDX21 Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-10528

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

Gu-alpha, GUA, Gu alpha, EC:3.6.4.13, DExD-box helicase 21

Formulation:  PBS and Azide
PBS and Azide
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-10528 targets DDX21 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0804

Product name: Recombinant human DDX21 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-180 aa of BC008071

Sequence: MPGKLRSDAGLESDTAMKKGETLRKQTEEKEKKEKPKSDKTEEIAEEEETVFPKAKQVKKKAEPSEVDMNSPKSKKAKKKEEPSQNDISPKTKSLRKKKEPIEKKVVSSKTKKVTKNEEPSEEEIDAPKPKKMKKEKEMNGETREKSPKLKNGFPHPEPDCNPSEAASEESNSEIEQEIP

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 21
Calculated Molecular Weight 87 kDa
Observed Molecular Weight 87 kDa
GenBank Accession NumberBC008071
Gene Symbol DDX21
Gene ID (NCBI) 9188
RRIDAB_2919737
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9NR30
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DX21 protein belongs to DEAD box protein family which is characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD). As a putative RNA helicase, DDX21 unwinds double-stranded RNA, folds single-stranded RNA and is involved in process including ribosomal RNA biogeneis, RNA editing and general transcription. Interaction of DDX21 and c-Jun was reported in ribosomal RNA processing. DDX21 exists as two isoforms, molecular weight of modified isoform one is about 87 -100 kDa, and the post-modified isoform is about 75-85 kDa. Catalog# 10528-1-AP is a rabbit polyclonal antibody raised against N-terminal of human DDX21.

Protocols

Product Specific Protocols
IF protocol for CL594 DDX21 antibody CL594-10528Download protocol
FC protocol for CL594 DDX21 antibody CL594-10528Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...