DDX3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DDX3 Polyclonal antibody (11115-1-AP)

• Featured Product
• KD/KO Validated

DDX3 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 11115-1-AP

Publications(47)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA

Synonyms

DDX3X, ATP-dependent RNA helicase DDX3X, CAP-Rf, DBX, DDX14

• 

  WB analysis using 11115-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HepG2 using 11115-1-AP

  WB result of DDX3 antibody (11115-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDX3 transfected HepG2 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11115-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11115-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 11115-1-AP

  WB result of DDX3 antibody (11115-1-AP; 1:3000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDX3 transfected HeLa cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse liver using 11115-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 11115-1-AP (DDX3 Antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 11115-1-AP

  IP result of anti-DDX3 (IP:11115-1-AP, 4ug; Detection:11115-1-AP 1:300) with HeLa cells lysate 2480ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 11115-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 11115-1-AP (DDX3 antibody) at dilution of 1:200 (under 40x lens)..

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 11115-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 11115-1-AP (DDX3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human cervical cancer using 11115-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 11115-1-AP (DDX3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human malignant melanoma using 11115-1-AP

  Immunohistochemical analysis of paraffin-embedded human malignant melanoma tissue slide using 11115-1-AP (DDX3 antibody) at dilution of 1:200 (under 10x lens)..

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11115-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DDX3 antibody (11115-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HepG2 using 11115-1-AP

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using DDX3 antibody (11115-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CL594-phalloidin (red).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 11115-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human DDX3 (11115-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, mouse brain tissue, mouse liver tissue, K-562 cells, C6 cells, PC-12 cells, rat brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human malignant melanoma tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11115-1-AP targets DDX3 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ChIP, RIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1614

  Product name: Recombinant human DDX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 312-662 aa of BC011819

  Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC011819
• Gene Symbol: DDX3
• Gene ID (NCBI): 1654
• RRID: AB_10896499
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00571
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX3X, also named as DBX, DDX3 and HLP2, belongs to the DEAD box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73 kDa is the target band. 60-65 kDa is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,CoIP	Cell; Diverse CMT2 neuropathies are linked to aberrant G3BP interactions in stress granules; Authors - Qinqin Cui
	IF	Neuron; Pathogenic DDX3X Mutations Impair RNA Metabolism and Neurogenesis during Fetal Cortical Development.; Authors - Ashley L Lennox
human	WB	Neuron; CRISPR-Cas9 Screens Identify the RNA Helicase DDX3X as a Repressor of C9ORF72 (GGGGCC)n Repeat-Associated Non-AUG Translation.; Authors - Weiwei Cheng ; KD Validated
human	WB	Cancer Lett; NR4A1 depletion inhibits colorectal cancer progression by promoting necroptosis via the RIG-I-like receptor pathway; Authors - Jinghan Zhu
human	WB	Pharmacol Res; HPV E7-drived ALKBH5 promotes cervical cancer progression by modulating m6A modification of PAK5; Authors - Fu-Chun Huo ; KD Validated
mouse	WB,IF,CoIP	Ecotoxicol Environ Saf; Aluminum exposure induces central nervous system impairment via activating NLRP3-medicated pyroptosis pathway; Authors - Wudi Hao

Reviews

5.0 out of 5

1 verified customer reviews

What customers say

Automatically generated from the verified customer reviews below by Able AI.

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

Shannon (Verified Customer) (07-19-2022)

Worked well, also binds to different isoforms/protein dimers

• Applications: Western Blot, Immunoprecipitation
• Primary Antibody Dilution: 1:2000
• Cell Tissue Type: Jurkat T-Cells

DDX3 Antibody Western Blot,Immunoprecipitation validation (1:2000 dilution) in Jurkat T-Cells (Cat no:11115-1-AP)