DDX3 Monoclonal antibody, PBS Only

• 

  WB analysis using 67915-1-Ig (same clone as 67915-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67915-1-Ig (DDX3 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours. The membrane was stripped and reblotted with HRP-conjugated GAPDH Monoclonal antibody (HRP-60004) as loading control. This data was developed using the same antibody clone with 67915-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HepG2 using 67915-1-Ig (same clone as 67915-1-PBS)

  WB result of DDX3 antibody (67915-1-Ig; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDX3 transfected HepG2 cells. This data was developed using the same antibody clone with 67915-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67915-1-Ig (same clone as 67915-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67915-1-Ig (DDX3 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67915-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67915-1-Ig (same clone as 67915-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67915-1-Ig (DDX3 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67915-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HepG2 using 67915-1-Ig (same clone as 67915-1-PBS)

  1X10^6 HepG2 cells were intracellularly stained with 0.5 ug Anti-Human DDX3 (67915-1-Ig, Clone:1D3A1) and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) at dilution 1:1000 (red), or 0.5 ug Mouse IgG2b Isotype Control (66360-3-Ig, Clone: K11B8C4B5) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011). This data was developed using the same antibody clone with 67915-1-PBS in a different storage buffer formulation.

DDX3 Monoclonal Antibody for WB, IHC, FC (Intra), Indirect ELISA

Cat No. 67915-1-PBS

Clone No.1D3A1

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

WB, IHC, FC (Intra), Indirect ELISA

Synonyms

DDX3X, DDX14, DBX, CAP-Rf, ATP-dependent RNA helicase DDX3X

---

Product Information

67915-1-PBS targets DDX3 in WB, IHC, FC (Intra), Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29972

  Product name: Recombinant human DDX3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 312-662 aa of BC011819

  Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 71-73 kDa
• GenBank Accession Number: BC011819
• Gene Symbol: DDX3
• Gene ID (NCBI): 1654
• RRID: AB_2918669
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00571
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DDX3X, also named DBX, DDX3, and HLP2, belongs to the DEAD-box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73kd is the target band. 60-65kd is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.