• Featured Product
  • KD/KO Validated

DDX3 Recombinant monoclonal antibody, PBS Only

DDX3 Uni-rAb® Recombinant Antibody for WB, IF/ICC, FC (Intra), Indirect ELISA
Cat No. 81903-1-PBS
Clone No.5C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), Indirect ELISA

DDX3X, 5C12, ATP-dependent RNA helicase DDX3X, CAP-Rf, DBX

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

81903-1-PBS targets DDX3 in WB, IF/ICC, FC (Intra), Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag1614

Product name: Recombinant human DDX3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 312-662 aa of BC011819

Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
Calculated Molecular Weight 73 kDa
Observed Molecular Weight75 kDa
GenBank Accession NumberBC011819
Gene Symbol DDX3
Gene ID (NCBI) 1654
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00571
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DDX3X, also named as DBX, DDX3 and HLP2, belongs to the DEAD box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73 kDa is the target band. 60-65 kDa is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.

Loading...
||
New chat Able
正在加载,请稍候...