DDX3 Recombinant monoclonal antibody

• 

  WB analysis of HepG2 using 81903-1-RR

  WB result of DDX3 antibody (81903-1-RR; 1:10000; incubated at room temperature for 1.5 hours) with sh-Control and sh-DDX3 transfected HepG2 cells.

• 

  WB analysis using 81903-1-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 81903-1-RR (DDX3 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 81903-1-RR

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using DDX3 antibody (81903-1-RR, Clone: 5C12 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  FC experiment of HepG2 using 81903-1-RR

  1x10^6 HepG2 cells were intracellularly stained with 0.4 ug DDX3 Recombinant antibody (81903-1-RR, Clone:5C12) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.4 ug rabbit IgG isotype control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

• Featured Product
• KD/KO Validated

DDX3 Uni-rAb^® Recombinant Antibody for WB, IF/ICC, FC (Intra), ELISA

Cat No. 81903-1-RR

Clone No.5C12

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, FC (Intra), ELISA

Synonyms

DDX3X, 5C12, ATP-dependent RNA helicase DDX3X, CAP-Rf, DBX

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, MCF-7 cells, K-562 cells, mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: HepG2 cells
• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

81903-1-RR targets DDX3 in WB, IF/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1614

  Product name: Recombinant human DDX3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 312-662 aa of BC011819

  Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC011819
• Gene Symbol: DDX3
• Gene ID (NCBI): 1654
• RRID: AB_2935591
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00571
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX3X, also named as DBX, DDX3 and HLP2, belongs to the DEAD box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73 kDa is the target band. 60-65 kDa is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.