CoraLite® Plus 488-conjugated DDX3 Monoclonal antibody

• 

  FC experiment of HepG2 using CL488-67915

  1X10^6 HepG2 cells were intracellularly stained with 0.4 ug CoraLite® Plus 488 Anti-Human DDX3 (CL488-67915, Clone:1D3A1) (red), or 0.4 ug Mouse IgG2b Isotype Control (CL488-66360-3, Clone: K11B8C4B5) (blue). Cells were fixed and permeabilized with Transcription Factor Staining Buffer Kit (PF00011).

• Featured Product
• KD/KO Validated

DDX3 Monoclonal Antibody for FC (Intra)

Cat No. CL488-67915

Clone No.1D3A1

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

FC (Intra)

Synonyms

DDX3X, DDX14, DBX, CAP-Rf, ATP-dependent RNA helicase DDX3X

---

Tested Applications

• Positive FC (Intra) detected in: HepG2 cells

Recommended dilution

• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67915 targets DDX3 in FC (Intra) applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29972

  Product name: Recombinant human DDX3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 312-662 aa of BC011819

  Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 71-73 kDa
• GenBank Accession Number: BC011819
• Gene Symbol: DDX3
• Gene ID (NCBI): 1654
• RRID: AB_2934591
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O00571
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DDX3X, also named DBX, DDX3, and HLP2, belongs to the DEAD-box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73kd is the target band. 60-65kd is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.