• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated DDX3 Monoclonal antibody

DDX3 Monoclonal Antibody for FC (Intra)
Cat No. CL488-67915
Clone No.1D3A1

Host / Isotype

Mouse / IgG2b

Reactivity

human, rat

Applications

FC (Intra)

DDX3X, DDX14, DBX, CAP-Rf, ATP-dependent RNA helicase DDX3X

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive FC (Intra) detected inHepG2 cells

Recommended dilution

ApplicationDilution
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-67915 targets DDX3 in FC (Intra) applications and shows reactivity with human, rat samples.

Tested Reactivity human, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag29972

Product name: Recombinant human DDX3 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 312-662 aa of BC011819

Sequence: DLERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEESDKRSFLLDLLNATGKDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVKHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNERNINITKDLLDLLVEAKQEVPSWLENMAYEHHYKGSSRGRSKSSRFSGGFGARDYRQSSGASSSSFSSSRASSSRSGGGGHGSSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, X-linked
Calculated Molecular Weight 73 kDa
Observed Molecular Weight71-73 kDa
GenBank Accession NumberBC011819
Gene Symbol DDX3
Gene ID (NCBI) 1654
RRIDAB_2934591
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00571
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DDX3X, also named DBX, DDX3, and HLP2, belongs to the DEAD-box helicase family and DDX3/DED1 subfamily. It is ATP-dependent RNA helicase. DDX3X acts as a cofactor for XPO1-mediated nuclear export of incompletely spliced HIV-1 Rev RNAs. It is also involved in HIV-1 replication. DDX3X interacts specifically with hepatitis C virus core protein resulting in a change in intracellular location. 73kd is the target band. 60-65kd is some other isoform. This antibody can bind both DDX3X and DDX3Y for the close sequences.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 DDX3 antibody CL488-67915Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...