• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated DDX39A Recombinant monoclonal antibody

DDX39A Uni-rAb® Recombinant Antibody for IF/ICC, FC (Intra)
Cat No. CL488-83083-5
Clone No.230375F9

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

DDX39, DDXL, BAT1L, BAT1, ATP-dependent RNA helicase DDX39A

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inJurkat cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83083-5 targets DDX39A in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2311

Product name: Recombinant human DDX39 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-322 aa of BC032128

Sequence: MAEQDVENDLLDYDEEEEPQAPQESTPAPPKKDIKGSYVSIHSSGFRDFLLKPELLRAIVDCGFEHPSEVQHECIPQAILGMDVLCQAKSGMGKTAVFVLATLQQIEPVNGQVTVLVMCHTRELAFQISKEYERFSKYMPSVKVSVFFGGLSIKKDEEVLKKNCPHVVVGTPGRILALVRNRSFSLKNVKHFVLDECDKMLEQLDMRRDVQEIFRLTPHEKQCMMFSATLSKDIRPVCRKFMQDPMEVFVDDETKLTLHGLQQYYVKLKDSEKNRKLFDLLDVLEFNQPVTLSAVQGFPAADPGGHQSVWPGDGHRASQHRL

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 39
Calculated Molecular Weight 427 aa, 49 kDa
Observed Molecular Weight50 kDa
GenBank Accession NumberBC032128
Gene Symbol DDX39
Gene ID (NCBI) 10212
RRIDAB_3673182
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodProtein A purification
UNIPROT IDO00148
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DDX39A, also named the BAT1 protein, contains the nine conserved motifs that characterize the DEAD-box family of RNA-binding proteins. The family includes proteins found in all eukaryotic cell types, with considerable divergence in the sequences lying between the conserved motifs. Some of the motifs were known before the definition of the family and are responsible for binding to mRNA or ATP, or possess ATPase activity. Phylogenetic analyses have grouped BAT1 with the defining member of the DEAD-box family, eIF-4. This is a translation initiation factor required for the dissociation of stem/loop structures in mRNA at the ribosomes.

Protocols

Product Specific Protocols
FC protocol for CL Plus 488 DDX39A antibody CL488-83083-5Download protocol
IF protocol for CL Plus 488 DDX39A antibody CL488-83083-5Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...