DDX3Y Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DDX3Y Polyclonal antibody, PBS Only (14041-1-PBS)

• 

  WB analysis using 14041-1-AP (same clone as 14041-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 14041-1-AP (DDX3Y antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 14041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14041-1-AP (same clone as 14041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14041-1-AP (DDX3Y antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14041-1-AP (same clone as 14041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14041-1-AP (DDX3Y antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 14041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14041-1-AP (same clone as 14041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis using 14041-1-AP (DDX3Y antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 14041-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human testis using 14041-1-AP (same clone as 14041-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human testis tissue slide using 14041-1-AP (DDX3Y antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 14041-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 14041-1-AP (same clone as 14041-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using DDX3Y antibody (14041-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 14041-1-PBS in a different storage buffer formulation.

DDX3Y Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 14041-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ATP-dependent RNA helicase DDX3Y, DBY, DEAD box protein 3, Y-chromosomal, EC:3.6.4.13

---

Product Information

14041-1-PBS targets DDX3Y in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5110

  Product name: Recombinant human DDX3Y protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 311-660 aa of BC034942

  Sequence: LERGCHLLVATPGRLVDMMERGKIGLDFCKYLVLDEADRMLDMGFEPQIRRIVEQDTMPPKGVRHTMMFSATFPKEIQMLARDFLDEYIFLAVGRVGSTSENITQKVVWVEDLDKRSFLLDILGATGSDSLTLVFVETKKGADSLEDFLYHEGYACTSIHGDRSQRDREEALHQFRSGKSPILVATAVAARGLDISNVRHVINFDLPSDIEEYVHRIGRTGRVGNLGLATSFFNEKNMNITKDLLDLLVEAKQEVPSWLENMAYEHHYKGGSRGRSKSNRFSGGFGARDYRQSSGSSSSGFGASRGSSSRSGGGGYGNSRGFGGGGYGGFYNSDGYGGNYNSQGVDWWGN

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 3, Y-linked
• Calculated Molecular Weight: 73 kDa
• Observed Molecular Weight: 73 kDa
• GenBank Accession Number: BC034942
• Gene Symbol: DDX3Y
• Gene ID (NCBI): 8653
• RRID: AB_2092884
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15523
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases which are implicated in a number of cellular processes involving RNA binding and alteration of RNA secondary structure. DDX3Y is one member of DEAD box RNA helicases, encode by the gene locate on the chromosome Y in the azoospermia factor A region. Polyclonal anti-DDX3Y antibodies (14041-1-AP) are produced by immunizing animals with C-terminus of DDX3Y and detect an 73-kDa band. As DDX3Y has a structural homolog with DDX3X, the antibody can recognize both.