Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
| Positive IP detected in | mouse testis tissue |
| Positive IHC detected in | mouse testis tissue, mouse ovary tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
51042-1-AP targets DDX4/VASA in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag0447 Product name: Recombinant human DDX4,VASA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 35-163 aa of BC047455 Sequence: NRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGDNDLDPDECMQRTGGLFGSRRPVLSGTGNGDT Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 4 |
| Calculated Molecular Weight | 690aa,76 kDa; 724aa,79 kDa |
| Observed Molecular Weight | 79 kDa |
| GenBank Accession Number | BC047455 |
| Gene Symbol | DDX4 |
| Gene ID (NCBI) | 54514 |
| RRID | AB_2092998 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9NQI0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DEAD box proteins are characterized by nine conserved sequence motifs located on two functional domains. Domain I contains six of these motifs, including the Q motif and the Walker A motif, motifs Ia and Ib, the Walker B motif, and motif III, which may act to link ATPase and helicase activities of the protein [PMID:21653890]. DDX4, a member of the DEAD box family of ATP-dependent RNA helicases, plays a central role in several aspects of germ cell development. Its function is not only required during gametogenesis in the adult but is also essential for the specification of the germ cell lineage during embryogenesis [PMID:20016130].
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX4/VASA antibody 51042-1-AP | Download protocol |
| IHC protocol for DDX4/VASA antibody 51042-1-AP | Download protocol |
| IP protocol for DDX4/VASA antibody 51042-1-AP | Download protocol |
| WB protocol for DDX4/VASA antibody 51042-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DDX4/VASA polyclonal antibody (Cat# 51042-1-AP) has 27 citations spanning journals including Nucleic Acids Research, Cell Death & Differentiation, Cell Reports, JCI Insight, Apoptosis, Phytomedicine, Life Sciences, Communications Biology, International Journal of Molecular Sciences, Oncotarget, and others. Research fields cover spermatogenesis, germ cell development, ovarian aging and insufficiency, testicular toxicity, fertility preservation, reproductive toxicology, and RNA homeostasis.
| Species | Application | Title |
|---|---|---|
Nucleic Acids Res The arginine methyltransferase Prmt1 coordinates the germline arginine methylome essential for spermatogonial homeostasis and male fertility | ||
Cell Death Differ Combinatorial tagging generates a multi-purpose knock-in mouse model revealing phase separation-dependent germ granules in RNA homeostasis and germline development | ||
Phytomedicine Zuogui pill ameliorates DNA damage and the senescence-associated secretory phenotype in ovarian stem cells to delay ovarian ageing through activation of SIRT1. | ||
Apoptosis CCDC134 enhances ovarian reserve function and angiogenesis by directly interacting with INHA in a mouse model of premature ovarian insufficiency | ||
Cell Rep Germline-specific RNA helicase DDX4 forms cytoplasmic granules in cancer cells and promotes tumor growth |
Reviews
What customers say
The single review for this product rates it 5 out of 5 stars. The reviewer used it for Western Blot at a 1:1000 dilution on mouse testis lysate and described it as a "very good antibody." Overall, the feedback is positive, indicating reliable performance in WB applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Hetty (Verified Customer) (04-10-2018) | very good antibody.
|
