DDX46 Recombinant monoclonal antibody, PBS Only (Capture)

DDX46 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test
Cat No. 85065-3-PBS
Clone No.242715E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

242715E10, DEAD box protein 46, EC:3.6.4.13, KIAA0801, Probable ATP-dependent RNA helicase DDX46

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85065-3-PBS targets DDX46 as part of a matched antibody pair:

MP01807-1: 85065-3-PBS capture and 85065-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10342

Product name: Recombinant human DDX46 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 682-1031 aa of BC012304

Sequence: GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Calculated Molecular Weight 1031 aa, 117 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC012304
Gene Symbol DDX46
Gene ID (NCBI) 9879
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7L014
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DDX46, also named as KIAA0801, is a 1031 amino acid protein, which belongs to the DEAD box helicase family. DDX46 has been shown to be required at the early step of pre-spliceosome assembly. It uses the energy released by the hydrolysis of ATP to rearrange local RNA-RNA or protein-RNA interactions. The nuclear DDX46 acted as a negative regulator of the antiviral innate response by recruiting the m6A'eraser' ALKBH5 to induce retention of antiviral innate mRNA in the nucleus.

Loading...
||
New chat

Able

正在加载,请稍候...