DDX46 Recombinant monoclonal antibody

• 

  WB analysis using 85065-3-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 85065-3-RR (DDX46 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of Human Hepatocellular cancer using 85065-3-RR

  Immunohistochemical analysis of paraffin-embedded Human Hepatocellular cancer slide using 85065-3-RR (DDX46 antibody) at dilution of 1:600 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of U-251 using 85065-3-RR

  Immunofluorescent analysis of (4% PFA) fixed U-251 cells using DDX46 antibody (85065-3-RR, Clone: 242715E10 ) at dilution of 1:500 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

• 

  Affinity and Kinetic Characterization of 85065-3-RR

  Biolayer interferometry (BLl) kinetic assays of 85065-3-RR against Human DDX46 were performed. The affinity constant is 51.9 pM.

DDX46 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 85065-3-RR

Clone No.242715E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

242715E10, DEAD box protein 46, EC:3.6.4.13, KIAA0801, Probable ATP-dependent RNA helicase DDX46

---

Tested Applications

• Positive WB detected in: HeLa cells, HEK-293 cells, A549 cells, U-251 cells, NIH/3T3 cells, rat testis tissue
• Positive IHC detected in: Human Hepatocellular cancer; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: U-251 cells

Recommended dilution

• Western Blot (WB): WB : 1:5000-1:50000
• Immunohistochemistry (IHC): IHC : 1:300-1:1200
• Immunofluorescence (IF)/ICC: IF/ICC : 1:250-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

85065-3-RR targets DDX46 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10342

  Product name: Recombinant human DDX46 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 682-1031 aa of BC012304

  Sequence: GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
• Calculated Molecular Weight: 1031 aa, 117 kDa
• Observed Molecular Weight: 140 kDa
• GenBank Accession Number: BC012304
• Gene Symbol: DDX46
• Gene ID (NCBI): 9879
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q7L014
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX46, also named as KIAA0801, is a 1031 amino acid protein, which belongs to the DEAD box helicase family. DDX46 has been shown to be required at the early step of pre-spliceosome assembly. It uses the energy released by the hydrolysis of ATP to rearrange local RNA-RNA or protein-RNA interactions. The nuclear DDX46 acted as a negative regulator of the antiviral innate response by recruiting the m6A'eraser' ALKBH5 to induce retention of antiviral innate mRNA in the nucleus.