DDX46 Recombinant monoclonal antibody

DDX46 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 85065-3-RR
Clone No.242715E10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

242715E10, DEAD box protein 46, EC:3.6.4.13, KIAA0801, Probable ATP-dependent RNA helicase DDX46

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inHeLa cells, HEK-293 cells, A549 cells, U-251 cells, NIH/3T3 cells, rat testis tissue
Positive IHC detected inHuman Hepatocellular cancer
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inU-251 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:300-1:1200
Immunofluorescence (IF)/ICCIF/ICC : 1:250-1:1000
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

85065-3-RR targets DDX46 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag10342

Product name: Recombinant human DDX46 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 682-1031 aa of BC012304

Sequence: GLDVKHLILVVNYSCPNHYEDYVHRAGRTGRAGNKGYAYTFITEDQARYAGDIIKALELSGTAVPPDLEKLWSDFKDQQKAEGKIIKKSSGFSGKGFKFDETEQALANERKKLQKAALGLQDSDDEDAAVDIDEQIESMFNSKKRVKDMAAPGTSSVPAPTAGNAEKLEIAKRLALRINAQKNLGIESQDVMQQATNAILRGGTILAPTVSAKTIAEQLAEKINAKLNYVPLEKQEEERQDGGQNESFKRYEEELEINDFPQTARWKVTSKEALQRISEYSEAAITIRGTYFPPGKEPKEGERKIYLAIESANELAVQKAKAEITRLIKEELIRLQNSYQPTNKGRYKVL

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 46
Calculated Molecular Weight 1031 aa, 117 kDa
Observed Molecular Weight140 kDa
GenBank Accession NumberBC012304
Gene Symbol DDX46
Gene ID (NCBI) 9879
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7L014
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DDX46, also named as KIAA0801, is a 1031 amino acid protein, which belongs to the DEAD box helicase family. DDX46 has been shown to be required at the early step of pre-spliceosome assembly. It uses the energy released by the hydrolysis of ATP to rearrange local RNA-RNA or protein-RNA interactions. The nuclear DDX46 acted as a negative regulator of the antiviral innate response by recruiting the m6A'eraser' ALKBH5 to induce retention of antiviral innate mRNA in the nucleus.

Protocols

Product Specific Protocols
IF protocol for DDX46 antibody 85065-3-RRDownload protocol
IHC protocol for DDX46 antibody 85065-3-RRDownload protocol
WB protocol for DDX46 antibody 85065-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...