Tested Applications
| Positive WB detected in | NCI-H1299 cells, A431 cells, HSC-T6 cells, HeLa cells, HEK-293 cell, HepG2 cells, HT-29 cells, NIH/3T3 cells, 4T1 cells |
| Positive IP detected in | HeLa cells |
| Positive IHC detected in | human colon cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:250-1:1000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:400-1:1600 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
67025-1-Ig targets DDX5 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, pig, bovine |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag24821 Product name: Recombinant human DDX5 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 434-614 aa of NM_004396 Sequence: RSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ Predict reactive species |
| Full Name | DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 |
| Observed Molecular Weight | 69 kDa |
| GenBank Accession Number | NM_004396 |
| Gene Symbol | DDX5 |
| Gene ID (NCBI) | 1655 |
| RRID | AB_2882340 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P17844 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
DDX5 or p68, a member of DEAD/H BOX, which has a characteristic DEAD box, is a proliferation-associated nuclear antigen. DDX5 involves in the alternative regulation of pre-mRNA splicing, act as a RNA helicase to increase tau exon10 inclusion in a RBM4-dependent manner. It's also a transcription coactivator for extrogen receptor ESR1 and androgen receptor AR. Once synergized with DDX17 and SRA1 RNA, DDX5 activated MYOD1 transcription activity and involved in skeletal muscle differentiation.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for DDX5 antibody 67025-1-Ig | Download protocol |
| IHC protocol for DDX5 antibody 67025-1-Ig | Download protocol |
| IP protocol for DDX5 antibody 67025-1-Ig | Download protocol |
| WB protocol for DDX5 antibody 67025-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The DDX5 Monoclonal antibody (Cat# 67025-1-Ig) has 14 citations across journals including J Am Chem Soc, Nucleic Acids Res, Theranostics, Advanced Science, Communications Biology, Cancer Biology & Therapy, Antiviral Research, Virology Journal, eLife, Redox Biology, Molecular and Cellular Neuroscience, and Science Advances. Research fields span DNA replication and repair, R-loop biology, tumorigenesis (glioblastoma, osteosarcoma), viral infection, RNA m⁶A modification, retinal photoreceptor biology, mitochondrial neuroprotection, and oocyte translation.
| Species | Application | Title |
|---|---|---|
J Am Chem Soc Polymerase η Recruits DHX9 Helicase to Promote Replication across Guanine Quadruplex Structures | ||
Theranostics LncRNA PRADX-mediated recruitment of PRC2/DDX5 complex suppresses UBXN1 expression and activates NF-κB activity, promoting tumorigenesis. | ||
Adv Sci (Weinh) Glutamine Deprivation Triggers Tribbles Homolog 3 Dependent G-Quadruplex Resolution to Maintain DNA Repair and Tumor Survival. | ||
Commun Biol Hypoxia-induced circPLOD2a/b promotes the aggressiveness of glioblastoma by suppressing XIRP1 through binding to HuR | ||
Cancer Biol Ther VAMP8 suppresses the metastasis via DDX5/β-catenin signal pathway in osteosarcoma |
Reviews
What customers say
The single review for this product reports a 5-star rating. The user performed a Western Blot on HeLa cell extract at a 1/1000 dilution with an overnight incubation at 4°C, and observed a specific band for DDX5. Overall, the feedback indicates reliable specificity and performance for Western Blot applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Roy (Verified Customer) (06-15-2024) | Specific band detected for DDX5 from HeLa cells extract (1/1000 dilution, Overnight incubation at 4°C).
|
