CoraLite®594-conjugated DDX5 Monoclonal antibody

DDX5 Monoclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL594-67025
Clone No.2D3D2

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

IF/ICC, FC (Intra)

HLR1, HELR, G17P1, EC:3.6.4.13, DDX5,p68

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL594-67025 targets DDX5 in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag24821

Product name: Recombinant human DDX5 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 434-614 aa of NM_004396

Sequence: RSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMKDDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRTGNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ

Predict reactive species
Full Name DEAD (Asp-Glu-Ala-Asp) box polypeptide 5
Observed Molecular Weight 69 kDa
GenBank Accession NumberNM_004396
Gene Symbol DDX5
Gene ID (NCBI) 1655
RRIDAB_2920073
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
Excitation LaserYellow-Green Laser (561 nm)
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP17844
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DDX5 or p68, a member of DEAD/H BOX, which has a characteristic DEAD box, is a proliferation-associated nuclear antigen. DDX5 involves in the alternative regulation of pre-mRNA splicing, act as a RNA helicase to increase tau exon10 inclusion in a RBM4-dependent manner. It's also a transcription coactivator for extrogen receptor ESR1 and androgen receptor AR. Once synergized with DDX17 and SRA1 RNA, DDX5 activated MYOD1 transcription activity and involved in skeletal muscle differentiation.

Protocols

Product Specific Protocols
FC protocol for CL594 DDX5 antibody CL594-67025Download protocol
IF protocol for CL594 DDX5 antibody CL594-67025Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...