DDX51 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DDX51 Polyclonal antibody, PBS Only (20149-1-PBS)

• 

  WB analysis using 20149-1-AP (same clone as 20149-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 20149-1-AP (DDX51 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20149-1-PBS in a different storage buffer formulation.

• 

  WB analysis of K-562 using 20149-1-AP (same clone as 20149-1-PBS)

  K-562 cells were subjected to SDS PAGE followed by western blot with 20149-1-AP (DDX51 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20149-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 20149-1-AP (same clone as 20149-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 20149-1-AP (DDX51 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20149-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 20149-1-AP (same clone as 20149-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 20149-1-AP (DDX51 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 20149-1-PBS in a different storage buffer formulation.

• 

  IP experiment of K-562 using 20149-1-AP (same clone as 20149-1-PBS)

  IP result of anti-DDX51 (IP:20149-1-AP, 4ug; Detection:20149-1-AP 1:1000) with K-562 cells lysate 1820 ug. This data was developed using the same antibody clone with 20149-1-PBS in a different storage buffer formulation.

DDX51 Polyclonal Antibody for WB, IP, Indirect ELISA

Cat No. 20149-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IP, Indirect ELISA

Synonyms

---

Product Information

20149-1-PBS targets DDX51 in WB, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13691

  Product name: Recombinant human DDX51 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 317-666 aa of BC040185

  Sequence: GQKSLAKEQESLVQKTADGYRCLADIVVATPGRLVDHIDQTPGFSLQQLRFLIIDEADRMIDSMHQSWLPRVVAAAFQSEDPADPCALLKRRQAQAVTAASTCCPQMPLQKLLFSATLTQNPEKLQQLGLHQPRLFSTGLAHRGLEDTDGDGDSGKYAFPVGLTHHYVPCSLSSKPLVVLHLVLEMGFSRVLCFTNSRENSHRLFLLVQAFGGVDVAEFSSRYGPGQRRMILKQFEQGKIQLLISTDATARGIDVQGVELVVNYDAPQYLRTYVHRVGRTARAGKTGQAFTLLLKVQERRFLRMLTEAGAPELQRHELSSKLLQPLVPRYEEALSKLEESVKEERKQRAA

• Full Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 51
• Calculated Molecular Weight: 666 aa, 72 kDa
• Observed Molecular Weight: 72-80 kDa
• GenBank Accession Number: BC040185
• Gene Symbol: DDX51
• Gene ID (NCBI): 317781
• RRID: AB_10665947
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8N8A6
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The DEAD-box family (DDX) consists of a group of RNA helicases with the activity to hydrolyze ATP and to unwind RNA. The major physiological role of this family was to regulate RNA metabolism including ribosome assembly, RNA splicing, and pre-rRNA processing. DDX51 was a new gene in DDX family composed of 666 amino acids. DDX51 gene was a member of RNA helicases family in charge of regulating RNA metabolism(PMID: 31966432).