Use Able AI chat for product recommendations

DELE1 Polyclonal antibody, PBS Only

DELE1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21904-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

DELE, KIAA0141, DAP3-binding cell death enhancer 1, DAP3-binding cell death enhancer 1 short form, DAP3-binding cell death enhancer 1, long form (DELE1(L) )

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 
SKU: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

21904-1-PBS targets DELE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag14615

Product name: Recombinant human KIAA0141 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 164-515 aa of BC007855

Sequence: QEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKPAQPQPTGEKEQDKSKTLSLEEAVTSIQQLFQLSVSITFNFLGTENMKSGDHTAAFSYFQKAAARGYSKAQYNAGLCHEHGRGTPRDISKAVLYYQLAASQGHSLAQYRYARCLLRDPASSWNPERQRAVSLLKQAADSGLREAQAFLGVLFTKEPYLDEQRAVKYLWLAANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGNEAAQERLRALFSMGAAAPGPSDLTVTGLKSFSSPSLCSLNTLLAGTSRLPHASSTGNLGLLCRSGHLGASLEASSRAIPPHPYPLERSVVRLGFG

Predict reactive species
Full Name KIAA0141
Calculated Molecular Weight 515 aa, 56 kDa
Observed Molecular Weight 56 kDa
GenBank Accession NumberBC007855
Gene Symbol DELE1
Gene ID (NCBI) 9812
RRIDAB_2878942
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ14154
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

DELE1, also known as KIAA0141, is a 515 amino acid protein, which localizes in Mitochondrion and is detected in liver, skeletal muscle, kidney, pancreas, spleen, thyroid, testis, ovary, small intestine and colon. DELE1 is essential for the induction of death receptor-mediated apoptosis through the regulation of caspase activation. Mitochondrial malfunction needs to be relayed to the cytosol, where an integrated stress response is triggered by the phosphorylation of eukaryotic translation initiation factor 2α(eIF2α) in mammalian cells. eIF2αphosphorylation is mediated by the four eIF2α kinases GCN2, HRI, PERK and PKR, which are activated by diverse types of cellular stress. OMA1, a mitochondrial stress-activated protease; and DELE1, a little-characterized protein that we found was associated with the inner mitochondrial membrane. Mitochondrial stress stimulates OMA1-dependent cleavage of DELE1 and leads to the accumulation of DELE1 in the cytosol, where it interacts with HRI and activates the eIF2α kinase activity of HRI. In addition, DELE1 is required for ATF4 translation downstream of eIF2α phosphorylation.

Loading...
||
New chat

Able

正在加载,请稍候...