DELE1 Polyclonal antibody, PBS Only

• Home
• Products
• Primary Antibodies
• DELE1 Polyclonal antibody, PBS Only (21904-1-PBS)

• 

  WB analysis of mouse lung using 21904-1-AP (same clone as 21904-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21904-1-AP (KIAA0141 Antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21904-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse lung using 21904-1-AP (same clone as 21904-1-PBS)

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 21904-1-AP (KIAA0141 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 21904-1-PBS in a different storage buffer formulation.

DELE1 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 21904-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, Indirect ELISA

Synonyms

DELE, KIAA0141, DAP3-binding cell death enhancer 1, DAP3-binding cell death enhancer 1 short form, DAP3-binding cell death enhancer 1, long form (DELE1(L) )

---

Product Information

21904-1-PBS targets DELE1 in WB, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14615

  Product name: Recombinant human KIAA0141 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 164-515 aa of BC007855

  Sequence: QEEASAQPRNFSHNSLRGARPQDPSEEGPGDFGFLHASSSIESEAKPAQPQPTGEKEQDKSKTLSLEEAVTSIQQLFQLSVSITFNFLGTENMKSGDHTAAFSYFQKAAARGYSKAQYNAGLCHEHGRGTPRDISKAVLYYQLAASQGHSLAQYRYARCLLRDPASSWNPERQRAVSLLKQAADSGLREAQAFLGVLFTKEPYLDEQRAVKYLWLAANNGDSQSRYHLGICYEKGLGVQRNLGEALRCYQQSAALGNEAAQERLRALFSMGAAAPGPSDLTVTGLKSFSSPSLCSLNTLLAGTSRLPHASSTGNLGLLCRSGHLGASLEASSRAIPPHPYPLERSVVRLGFG

• Full Name: KIAA0141
• Calculated Molecular Weight: 515 aa, 56 kDa
• Observed Molecular Weight: 56 kDa
• GenBank Accession Number: BC007855
• Gene Symbol: DELE1
• Gene ID (NCBI): 9812
• RRID: AB_2878942
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14154
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

DELE1, also known as KIAA0141, is a 515 amino acid protein, which localizes in Mitochondrion and is detected in liver, skeletal muscle, kidney, pancreas, spleen, thyroid, testis, ovary, small intestine and colon. DELE1 is essential for the induction of death receptor-mediated apoptosis through the regulation of caspase activation. Mitochondrial malfunction needs to be relayed to the cytosol, where an integrated stress response is triggered by the phosphorylation of eukaryotic translation initiation factor 2α(eIF2α) in mammalian cells. eIF2αphosphorylation is mediated by the four eIF2α kinases GCN2, HRI, PERK and PKR, which are activated by diverse types of cellular stress. OMA1, a mitochondrial stress-activated protease; and DELE1, a little-characterized protein that we found was associated with the inner mitochondrial membrane. Mitochondrial stress stimulates OMA1-dependent cleavage of DELE1 and leads to the accumulation of DELE1 in the cytosol, where it interacts with HRI and activates the eIF2α kinase activity of HRI. In addition, DELE1 is required for ATF4 translation downstream of eIF2α phosphorylation.