DENR Polyclonal antibody

• Home
• Products
• Primary Antibodies
• DENR Polyclonal antibody (10656-1-AP)

• Featured Product
• KD/KO Validated

DENR Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10656-1-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA
For FC, select conjugated version.

Synonyms

Density-regulated protein, DRP, DRP1, H14, Protein DRP1

• 

  WB analysis of A431 using 10656-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse brain using 10656-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A431 using 10656-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 10656-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HEK-293 using 10656-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 10656-1-AP

  IP result of anti-DENR (IP:10656-1-AP, 4ug; Detection:10656-1-AP 1:600) with HeLa cells lysate 1200 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10656-1-AP (DENR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10656-1-AP (DENR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human liver cancer using 10656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10656-1-AP (DENR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HEK-293 using 10656-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using DENR antibody (10656-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of A431 using 10656-1-AP

  Immunofluorescent analysis of A431 cells using 10656-1-AP (DENR antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for DENR in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A431 cells, mouse lung tissue, HEK-293 cells, mouse brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10656-1-AP targets DENR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1023

  Product name: Recombinant human DENR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC007860

  Sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

• Full Name: density-regulated protein
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC007860
• Gene Symbol: DENR
• Gene ID (NCBI): 8562
• RRID: AB_2092124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43583
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DENR, also named as SMAP-3 or DRP1, is a 198 amino acid protein, which is highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. DENR is Up-regulated with increasing cell-density by HNRNPD and Up-regulated in ovarian and breast cancer cells by ERBB2 overexpression. The calculated molecular weight of DENR is 22 kDa, but the modified protein is about 25-30 kDa. (PMID: 27239039 )

Publications

What published studies show

The DENR Polyclonal antibody (Cat# 10656-1-AP) has 16 citations published in journals including Cancer Research, Nature Communications, Cell Reports, FASEB Journal, Scientific Reports, Nutrients, Journal of Cellular and Molecular Medicine, Biochemical and Biophysical Research Communications, Frontiers in Endocrinology, Frontiers in Medicine, Reproductive Sciences, BMC Complementary Medicine and Therapies, American Journal of Translational Research, and Aging. Research fields span cancer biology, mitochondrial dynamics, apoptosis, ischemia-reperfusion injury, obesity, viral replication, and ferroptosis.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human		Cancer Res; MYC Drives mRNA Pseudouridylation to Mitigate Proliferation-Induced Cellular Stress during Cancer Development; Authors - Jane Ding
mouse,human	WB	Nat Commun; DENR controls JAK2 translation to induce PD-L1 expression for tumor immune evasion.; Authors - Baiwen Chen
human	WB	Cell Rep; CRISPR screening reveals a dependency on ribosome recycling for efficient SARS-CoV-2 programmed ribosomal frameshifting and viral replication; Authors - Frederick Rehfeld ; KD Validated
zebrafish	WB	Nutrients; A High-Fat Diet Induces Muscle Mitochondrial Dysfunction and Impairs Swimming Capacity in Zebrafish: A New Model of Sarcopenic Obesity.; Authors - Yun-Yi Zou
Rat		Front Endocrinol (Lausanne); Cangfudaotan decoction inhibits mitochondria-dependent apoptosis of granulosa cells in rats with polycystic ovarian syndrome; Authors - Xiao-Lin Jiang
human	WB	Sci Rep; A screening strategy for the discovery of drugs that reduce C/EBPβ-LIP translation with potential calorie restriction mimetic properties.; Authors - Mohamad A Zaini ; KO Validated