DENR Polyclonal antibody

• 

  WB analysis of A431 using 10656-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 10656-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 10656-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A431 using 10656-1-AP

  A431 cells were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse lung using 10656-1-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10656-1-AP (DENR antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 10656-1-AP

  IP result of anti-DENR (IP:10656-1-AP, 4ug; Detection:10656-1-AP 1:600) with HeLa cells lysate 1200 ug.

• 

  IHC staining of human liver cancer using 10656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10656-1-AP (DENR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 10656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10656-1-AP (DENR antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human liver cancer using 10656-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10656-1-AP (DENR antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HEK-293 using 10656-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HEK-293 cells using DENR antibody (10656-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• 

  IF Staining of A431 using 10656-1-AP

  Immunofluorescent analysis of A431 cells using 10656-1-AP (DENR antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

DENR Polyclonal Antibody for WB, IHC, IF/ICC, IP, ELISA

Cat No. 10656-1-AP

Publications(15)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

SMAP 3, Protein DRP1, H14, DRP1, DRP

---

Tested Applications

• Positive WB detected in: A431 cells, mouse lung tissue, HEK-293 cells, mouse brain tissue
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HEK-293 cells, A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 13 publications below

Product Information

10656-1-AP targets DENR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, zebrafish
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1023

  Product name: Recombinant human DENR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-198 aa of BC007860

  Sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

• Full Name: density-regulated protein
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC007860
• Gene Symbol: DENR
• Gene ID (NCBI): 8562
• RRID: AB_2092124
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O43583
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DENR, also named as SMAP-3 or DRP1, is a 198 amino acid protein, which is highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. DENR is Up-regulated with increasing cell-density by HNRNPD and Up-regulated in ovarian and breast cancer cells by ERBB2 overexpression. The calculated molecular weight of DENR is 22 kDa, but the modified protein is about 25-30 kDa. (PMID: 27239039 )

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB	Nat Commun; DENR controls JAK2 translation to induce PD-L1 expression for tumor immune evasion.; Authors - Baiwen Chen
human		Cancer Res; MYC Drives mRNA Pseudouridylation to Mitigate Proliferation-Induced Cellular Stress during Cancer Development; Authors - Jane Ding
human	WB	Cell Rep; CRISPR screening reveals a dependency on ribosome recycling for efficient SARS-CoV-2 programmed ribosomal frameshifting and viral replication; Authors - Frederick Rehfeld ; KD Validated
human	WB	Sci Rep; A screening strategy for the discovery of drugs that reduce C/EBPβ-LIP translation with potential calorie restriction mimetic properties.; Authors - Mohamad A Zaini ; KO Validated
zebrafish	WB	Nutrients; A High-Fat Diet Induces Muscle Mitochondrial Dysfunction and Impairs Swimming Capacity in Zebrafish: A New Model of Sarcopenic Obesity.; Authors - Yun-Yi Zou
rat	WB	J Cell Mol Med; A possible new activator of PI3K-Huayu Qutan Recipe alleviates mitochondrial apoptosis in obesity rats with acute myocardial infarction.; Authors - He Tai