• Featured Product
  • KD/KO Validated

CoraLite® Plus 488-conjugated DENR Polyclonal antibody

DENR Polyclonal Antibody for IF/ICC, FC (Intra)
Cat No. CL488-10656

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IF/ICC, FC (Intra)

SMAP 3, Protein DRP1, H14, DRP1, DRP

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHEK-293 cells
Positive FC (Intra) detected inHEK-293 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.80 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

CL488-10656 targets DENR in IF/ICC, FC (Intra) applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag1023

Product name: Recombinant human DENR protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-198 aa of BC007860

Sequence: MAADISESSGADCKGDPRNSAKLDADYPLRVLYCGVCSLPTEYCEYMPDVAKCRQWLEKNFPNEFAKLTVENSPKQEAGISEGQGTAGEEEEKKKQKRGGRGQIKQKKKTVPQKVTIAKIPRAKKKYVTRVCGLATFEIDLKEAQRFFAQKFSCGASVTGEDEIIIQGDFTDDIIDVIQEKWPEVDDDSIEDLGEVKK

Predict reactive species
Full Name density-regulated protein
Calculated Molecular Weight 27 kDa
Observed Molecular Weight 27-30 kDa
GenBank Accession NumberBC007860
Gene Symbol DENR
Gene ID (NCBI) 8562
RRIDAB_3672457
Conjugate CoraLite® Plus 488 Fluorescent Dye
Excitation/Emission Maxima Wavelengths493 nm / 522 nm
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO43583
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

DENR, also named as SMAP-3 or DRP1, is a 198 amino acid protein, which is highly expressed in heart and skeletal muscle and moderately expressed in the brain, placenta, liver and pancreas. DENR is Up-regulated with increasing cell-density by HNRNPD and Up-regulated in ovarian and breast cancer cells by ERBB2 overexpression. The calculated molecular weight of DENR is 22 kDa, but the modified protein is about 25-30 kDa. (PMID: 27239039 )

Protocols

Product Specific Protocols
IF protocol for CL Plus 488 DENR antibody CL488-10656Download protocol
FC protocol for CL Plus 488 DENR antibody CL488-10656Download protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...