CoraLite® Plus 488-conjugated DGAT2 Recombinant monoclonal antibody

• 

  IF Staining of HepG2 using CL488-83262-2

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using CoraLite® Plus 488 DGAT2 antibody (CL488-83262-2, Clone: 240171C6 ) at dilution of 1:200.

DGAT2 Uni-rAb^® Recombinant Antibody for IF/ICC

Cat No. CL488-83262-2

Clone No.240171C6

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IF/ICC

Synonyms

EC:2.3.1.20, Diglyceride acyltransferase 2, Diacylglycerol O-acyltransferase 2, ARAT, Acyl-CoA retinol O-fatty-acyltransferase

---

Tested Applications

• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-83262-2 targets DGAT2 in IF/ICC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10719

  Product name: Recombinant human DGAT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 113-388 aa of BC015234

  Sequence: DWNTPKKGGRRSQWVRNWAVWRYFRDYFPIQLVKTHNLLTTRNYIFGYHPHGIMGLGAFCNFSTEATEVSKKFPGIRPYLATLAGNFRMPVLREYLMSGGICPVSRDTIDYLLSKNGSGNAIIIVVGGAAESLSSMPGKNAVTLRNRKGFVKLALRHGADLVPIYSFGENEVYKQVIFEEGSWGRWVQKKFQKYIGFAPCIFHGRGLFSSDTWGLVPYSKPITTVVGEPITIPKLEHPTQQDIDLYHTMYMEALVKLFDKHKTKFGLPETEVLEVN

• Full Name: diacylglycerol O-acyltransferase homolog 2 (mouse)
• Calculated Molecular Weight: 388 aa, 44 kDa
• GenBank Accession Number: BC015234
• Gene Symbol: DGAT2
• Gene ID (NCBI): 84649
• RRID: AB_3673229
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q96PD7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

Diacylglycerol acyltransferase 2 (DGAT2) is an integral membrane protein and major enzyme that catalyzes the final step of triacylglycerol (TG) synthesis in eukaryotes (PMID: 21680734). DGAT2 is present in mitochondria-associated membranes, specialized domains of the ER that are highly enriched in lipid synthetic enzymes (PMID: 19049983). DGAT2 isoforms (39 kDa, 44kDa) have major differences in acyl-CoA substrate specificity toward erucoyl-CoA.