DHRS1 Polyclonal antibody

• 

  WB analysis using 16275-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16275-1-AP (DHRS1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 16275-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 16275-1-AP (DHRS1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human liver using 16275-1-AP

  human liver tissue were subjected to SDS PAGE followed by western blot with 16275-1-AP (DHRS1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human kidney using 16275-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16275-1-AP (DHRS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human kidney using 16275-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 16275-1-AP (DHRS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human skin using 16275-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 16275-1-AP (DHRS1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver using 16275-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16275-1-AP (DHRS1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human liver using 16275-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16275-1-AP (DHRS1 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human skin using 16275-1-AP

  Immunohistochemical analysis of paraffin-embedded human skin using 16275-1-AP (DHRS1 antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of A431 using 16275-1-AP

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using DHRS1 antibody (16275-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002), CL594-phalloidin (red).

DHRS1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 16275-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

Short chain dehydrogenase/reductase family 19C member 1, SDR19C1, Protein SDR19C1, EC:1.1.1.-

---

Tested Applications

• Positive WB detected in: COLO 320 cells, human liver tissue, mouse colon tissue, mouse testis tissue
• Positive IHC detected in: human kidney tissue, human skin tissue, human liver tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

16275-1-AP targets DHRS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9351

  Product name: Recombinant human DHRS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-313 aa of BC014057

  Sequence: MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF

• Full Name: dehydrogenase/reductase (SDR family) member 1
• Calculated Molecular Weight: 313 aa, 34 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC014057
• Gene Symbol: DHRS1
• Gene ID (NCBI): 115817
• RRID: AB_2292847
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LJ7
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DHRS1(Dehydrogenase/reductase SDR family member 1) is also named as LJ25430, MGC20204, DKFZp586I0523, SDR19C1, FLJ14250 and belongs to the short-chain dehydrogenases/reductases (SDR) family. It is involved in the metabolism of a large variety of compounds, including steroid hormones, prostaglandins, retinoids, lipids and xenobiotics.Northern blot analysis detected DHRS1express in heart highest and in liver lowest.