DHRS1 Polyclonal antibody

DHRS1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 16275-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

Short chain dehydrogenase/reductase family 19C member 1, SDR19C1, Protein SDR19C1, EC:1.1.1.-

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCOLO 320 cells, human liver tissue, mouse colon tissue, mouse testis tissue
Positive IHC detected inhuman kidney tissue, human skin tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inA431 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16275-1-AP targets DHRS1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag9351

Product name: Recombinant human DHRS1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-313 aa of BC014057

Sequence: MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF

Predict reactive species
Full Name dehydrogenase/reductase (SDR family) member 1
Calculated Molecular Weight 313 aa, 34 kDa
Observed Molecular Weight 35-38 kDa
GenBank Accession NumberBC014057
Gene Symbol DHRS1
Gene ID (NCBI) 115817
RRIDAB_2292847
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ96LJ7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

DHRS1(Dehydrogenase/reductase SDR family member 1) is also named as LJ25430, MGC20204, DKFZp586I0523, SDR19C1, FLJ14250 and belongs to the short-chain dehydrogenases/reductases (SDR) family. It is involved in the metabolism of a large variety of compounds, including steroid hormones, prostaglandins, retinoids, lipids and xenobiotics.Northern blot analysis detected DHRS1express in heart highest and in liver lowest.

Protocols

Product Specific Protocols
IF protocol for DHRS1 antibody 16275-1-APDownload protocol
IHC protocol for DHRS1 antibody 16275-1-APDownload protocol
WB protocol for DHRS1 antibody 16275-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...