CoraLite® Plus 488-conjugated DHRS1 Polyclonal antibody

• 

  IF Staining of A431 using CL488-16275

  Immunofluorescent analysis of (4% PFA) fixed A431 cells using CoraLite® Plus 488 DHRS1 antibody (CL488-16275) at dilution of 1:200, CL594-phalloidin (red).

DHRS1 Polyclonal Antibody for IF/ICC

Cat No. CL488-16275

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IF/ICC

Synonyms

Short chain dehydrogenase/reductase family 19C member 1, SDR19C1, Protein SDR19C1, EC:1.1.1.-

---

Tested Applications

• Positive IF/ICC detected in: A431 cells

Recommended dilution

• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

CL488-16275 targets DHRS1 in IF/ICC applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9351

  Product name: Recombinant human DHRS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-313 aa of BC014057

  Sequence: MAAPMNGQVCVVTGASRGIGRGIALQLCKAGATVYITGRHLDTLRVVAQEAQSLGGQCVPVVCDSSQESEVRSLFEQVDREQQGRLDVLVNNAYAGVQTILNTRNKAFWETPASMWDDINNVGLRGHYFCSVYGARLMVPAGQGLIVVISSPGSLQYMFNVLYGVGKAACDKLAADCAHELRRHGVSCVSLWPGIVQTELLKEHMAKEEVLQDPVLKQFKSAFSSAETTELSGKCVVALATDPNILSLSGKVLPSCDLARRYGLRDVDGRPVQDYLSLSSVLSHVSGLGWLASYLPSFLRVPKWIIALYTSKF

• Full Name: dehydrogenase/reductase (SDR family) member 1
• Calculated Molecular Weight: 313 aa, 34 kDa
• Observed Molecular Weight: 35-38 kDa
• GenBank Accession Number: BC014057
• Gene Symbol: DHRS1
• Gene ID (NCBI): 115817
• RRID: AB_3672648
• Conjugate: CoraLite® Plus 488 Fluorescent Dye
• Excitation/Emission Maxima Wavelengths: 493 nm / 522 nm
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96LJ7
• Storage Buffer: PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
• Storage Conditions: Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage.

Background Information

DHRS1(Dehydrogenase/reductase SDR family member 1) is also named as LJ25430, MGC20204, DKFZp586I0523, SDR19C1, FLJ14250 and belongs to the short-chain dehydrogenases/reductases (SDR) family. It is involved in the metabolism of a large variety of compounds, including steroid hormones, prostaglandins, retinoids, lipids and xenobiotics.Northern blot analysis detected DHRS1express in heart highest and in liver lowest.